YVOF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVOF - Putative acetyltransferase YvoF

UniProt:	O34993	Sequences: MRKTDRHPVSGANSLWHVYQTVPFLKVVKNFIVIQIARYTPFIGMKNWLYRTFLRMKVGKQTSFALMVMPDIMFPEKISVGTNTIIGYNTTILAHEYLIHEYRIGKVLIGDEVMIGANTTILPGVKIGDGAVVSAGTLVHKDVPDGAFVGGNPMRIIYTKEEMQERLKKSAE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	172 (137)
Sequences:	7039 (4707)
Seq/√Len:	402.2

ECOLI - WCAF THGA WBBJ MAA WCAB CYSE YRDA CAIE PAAY YAIX LPXD
BACSU - YVOF MAA CYSE DAPH EPSM YTOA
HALSA - Q9HQ06 Q9HPT3 Q9HNN1
SULSO - Q980E1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
130_G	146_G	3.142	1.00
110_G	129_D	3.015	1.00
61_Q	83_N	2.980	1.00
70_P	78_I	2.678	1.00
143_V	149_V	2.647	1.00
92_I	107_V	2.615	1.00
112_E	130_G	2.583	1.00
134_S	150_G	2.443	1.00
129_D	145_D	2.442	1.00
60_K	82_T	2.435	1.00
111_D	129_D	2.401	1.00
57_K	79_S	2.386	1.00
150_G	157_I	2.247	1.00
122_L	135_A	2.105	1.00
38_R	57_K	2.034	1.00
110_G	126_K	1.997	1.00
149_V	154_M	1.989	1.00
131_A	147_A	1.861	1.00
147_A	159_T	1.854	1.00
67_M	89_N	1.845	1.00
59_G	82_T	1.841	1.00
83_N	112_E	1.735	1.00
126_K	142_D	1.721	1.00
79_S	108_L	1.685	1.00
137_T	154_M	1.682	1.00
131_A	145_D	1.676	1.00
149_V	156_I	1.670	1.00
93_L	117_A	1.654	1.00
81_G	111_D	1.582	1.00
131_A	143_V	1.571	1.00
58_V	62_T	1.524	1.00
29_K	33_V	1.519	1.00
156_I	159_T	1.471	1.00
108_L	126_K	1.451	1.00
144_P	156_I	1.448	1.00
125_V	142_D	1.423	1.00
40_T	60_K	1.409	1.00
147_A	156_I	1.405	1.00
89_N	118_N	1.396	1.00
115_I	121_I	1.362	1.00
62_T	82_T	1.315	1.00
109_I	115_I	1.301	1.00
57_K	77_K	1.269	1.00
128_G	145_D	1.253	1.00
144_P	147_A	1.251	1.00
133_V	143_V	1.223	1.00
42_F	61_Q	1.221	1.00
100_H	103_R	1.207	1.00
75_P	104_I	1.203	1.00
120_T	136_G	1.198	1.00
92_I	109_I	1.186	1.00
115_I	119_T	1.160	1.00
82_T	111_D	1.145	1.00
64_F	68_V	1.134	1.00
76_E	104_I	1.095	1.00
39_Y	43_I	1.093	1.00
99_I	132_V	1.082	1.00
62_T	84_T	1.056	1.00
91_T	118_N	1.054	1.00
110_G	145_D	1.054	1.00
58_V	64_F	1.051	1.00
31_F	35_Q	1.042	1.00
113_V	131_A	1.040	1.00
133_V	139_V	1.031	1.00
86_I	92_I	1.017	1.00
144_P	149_V	1.006	1.00
138_L	152_N	0.988	1.00
81_G	110_G	0.982	1.00
27_V	30_N	0.979	1.00
86_I	115_I	0.977	1.00
86_I	90_T	0.969	1.00
62_T	111_D	0.951	1.00
84_T	129_D	0.948	1.00
80_V	92_I	0.933	1.00
112_E	129_D	0.928	1.00
133_V	149_V	0.925	1.00
69_M	89_N	0.924	1.00
90_T	119_T	0.918	1.00
80_V	86_I	0.917	1.00
113_V	129_D	0.916	1.00
122_L	140_H	0.912	1.00
113_V	145_D	0.900	1.00
62_T	80_V	0.890	1.00
58_V	80_V	0.890	1.00
84_T	111_D	0.878	1.00
99_I	148_F	0.878	1.00
109_I	113_V	0.877	1.00
27_V	31_F	0.876	1.00
148_F	160_K	0.873	1.00
64_F	70_P	0.851	1.00
64_F	86_I	0.842	1.00
132_V	148_F	0.842	1.00
129_D	146_G	0.838	1.00
51_R	56_M	0.837	1.00
24_F	27_V	0.829	1.00
69_M	73_M	0.822	1.00
128_G	142_D	0.821	1.00
96_E	105_G	0.821	1.00
127_I	133_V	0.814	1.00
91_T	120_T	0.813	1.00
91_T	117_A	0.805	1.00
55_R	77_K	0.805	1.00
41_P	60_K	0.804	1.00
33_V	37_A	0.797	1.00
119_T	137_T	0.796	1.00
33_V	39_Y	0.793	1.00
80_V	84_T	0.787	1.00
118_N	136_G	0.787	1.00
36_I	39_Y	0.787	1.00
68_V	90_T	0.785	1.00
43_I	62_T	0.778	1.00
136_G	152_N	0.777	1.00
81_G	108_L	0.770	1.00
48_W	51_R	0.755	1.00
77_K	106_K	0.752	1.00
120_T	138_L	0.752	1.00
26_K	30_N	0.750	1.00
42_F	60_K	0.748	1.00
37_A	40_T	0.742	1.00
97_Y	114_M	0.740	1.00
110_G	131_A	0.731	1.00
46_K	63_S	0.714	1.00
110_G	128_G	0.713	1.00
147_A	150_G	0.709	1.00
158_Y	161_E	0.705	1.00
125_V	141_K	0.703	1.00
150_G	154_M	0.697	1.00
88_Y	117_A	0.696	1.00
30_N	34_I	0.692	1.00
107_V	123_P	0.689	1.00
146_G	159_T	0.686	1.00
148_F	158_Y	0.684	1.00
62_T	86_I	0.678	0.99
142_D	149_V	0.677	0.99
98_L	103_R	0.675	0.99
79_S	106_K	0.666	0.99
87_G	114_M	0.666	0.99
130_G	145_D	0.661	0.99
25_L	29_K	0.648	0.99
137_T	152_N	0.647	0.99
50_Y	67_M	0.643	0.99
92_I	121_I	0.642	0.99
45_M	49_L	0.642	0.99
43_I	46_K	0.637	0.99
46_K	66_L	0.633	0.99
80_V	109_I	0.630	0.99
26_K	29_K	0.629	0.99
147_A	160_K	0.624	0.99
139_V	154_M	0.623	0.99
56_M	70_P	0.623	0.99
52_T	75_P	0.620	0.99
50_Y	66_L	0.620	0.99
131_A	149_V	0.619	0.99
109_I	121_I	0.616	0.99
45_M	48_W	0.616	0.99
127_I	131_A	0.615	0.99
128_G	131_A	0.612	0.99
105_G	124_G	0.610	0.99
83_N	111_D	0.607	0.99
45_M	51_R	0.607	0.99
84_T	109_I	0.605	0.99
128_G	144_P	0.605	0.99
70_P	92_I	0.599	0.99
96_E	99_I	0.599	0.99
84_T	113_V	0.597	0.99
50_Y	53_F	0.596	0.99
43_I	58_V	0.594	0.99
59_G	84_T	0.593	0.99
37_A	57_K	0.587	0.98
136_G	140_H	0.583	0.98
109_I	127_I	0.579	0.98
95_H	104_I	0.571	0.98
121_I	127_I	0.570	0.98
140_H	154_M	0.568	0.98
99_I	102_Y	0.567	0.98
148_F	157_I	0.567	0.98
121_I	125_V	0.561	0.98
128_G	149_V	0.556	0.98
81_G	84_T	0.556	0.98
32_I	36_I	0.553	0.98
77_K	108_L	0.552	0.98
49_L	68_V	0.552	0.98
76_E	94_A	0.550	0.98
96_E	123_P	0.548	0.98
28_V	31_F	0.547	0.98
98_L	102_Y	0.544	0.98
46_K	51_R	0.539	0.97
143_V	147_A	0.539	0.97
69_M	88_Y	0.538	0.97
48_W	67_M	0.533	0.97
48_W	52_T	0.532	0.97
59_G	81_G	0.532	0.97
150_G	155_R	0.528	0.97
34_I	37_A	0.527	0.97
55_R	75_P	0.526	0.97
137_T	150_G	0.525	0.97
33_V	41_P	0.524	0.97
75_P	95_H	0.521	0.97
93_L	120_T	0.519	0.97
126_K	145_D	0.516	0.97
122_L	138_L	0.507	0.96
23_P	27_V	0.507	0.96
32_I	58_V	0.505	0.96
63_S	85_I	0.503	0.96
107_V	125_V	0.500	0.96
65_A	114_M	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3fttA	3	0.9419	100	0.285	Contact Map
3srtA	3	0.9302	100	0.294	Contact Map
3nz2A	4	0.9244	100	0.298	Contact Map
1krrA	3	0.9884	100	0.3	Contact Map
3hjjA	3	0.9302	100	0.308	Contact Map
2p2oA	3	0.9244	100	0.313	Contact Map
1ocxA	3	0.9128	100	0.337	Contact Map
3vbiA	3	0.8488	99.9	0.406	Contact Map
3eevA	3	0.8023	99.9	0.412	Contact Map
1xatA	3	0.7965	99.9	0.418	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.