DAPH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DAPH - 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase

UniProt:	O34981	Sequences: MKMMDANEIISFIQNSTKSTPVKVYVKGELEGINFGESAKAFINGNTGVVFGEWSEIQTAIEENQSKIEDYVVENDRRNSAIPMLDLKNIKARIEPGAIIRDQVEIGDNAVIMMGASINIGSVIGEGTMIDMNVVLGGRATVGKNCHIGAGSVLAGVIEPPSAKPVVIEDDVVIGANAVVLEGVTVGKGAVVAAGAIVVNDVEPYTVVAGTPAKKIKDIDEKTKGKTEIKQELRQL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	236 (185)
Sequences:	3749 (2476)
Seq/√Len:	182.0

ECOLI - GLMU LPXD
BACSU - DAPH GLMU EPSM
HALSA - Q9HNN1
SULSO - Q7LXK9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_N	21_P	3.609	1.00
136_L	140_A	3.573	1.00
127_G	145_N	3.192	1.00
145_N	171_D	3.055	1.00
11_S	20_T	2.915	1.00
125_G	144_K	2.865	1.00
105_E	123_V	2.680	1.00
139_R	156_G	2.584	1.00
107_G	126_E	2.499	1.00
126_E	144_K	2.453	1.00
108_D	126_E	2.315	1.00
44_N	66_S	2.277	1.00
170_D	188_K	2.224	1.00
86_D	89_N	2.165	1.00
84_M	88_K	2.144	1.00
115_G	133_N	2.136	1.00
171_D	189_G	2.101	1.00
123_V	141_T	2.072	1.00
86_D	106_I	2.045	1.00
143_G	170_D	2.032	1.00
167_V	185_T	2.021	1.00
169_E	185_T	1.950	1.00
146_C	188_K	1.932	1.00
179_V	194_A	1.895	1.00
171_D	188_K	1.881	1.00
144_K	170_D	1.817	1.00
169_E	188_K	1.768	1.00
103_Q	121_G	1.753	1.00
141_T	167_V	1.703	1.00
132_M	150_A	1.687	1.00
119_N	138_G	1.661	1.00
178_A	194_A	1.654	1.00
133_N	151_G	1.638	1.00
110_A	128_T	1.621	1.00
83_P	93_R	1.621	1.00
118_I	122_S	1.619	1.00
94_I	111_V	1.615	1.00
107_G	125_G	1.607	1.00
104_V	118_I	1.590	1.00
40_K	66_S	1.577	1.00
18_K	21_P	1.552	1.00
140_A	154_L	1.547	1.00
110_A	144_K	1.539	1.00
146_C	172_V	1.516	1.00
186_V	190_A	1.494	1.00
142_V	148_I	1.491	1.00
41_A	62_E	1.480	1.00
136_L	142_V	1.466	1.00
85_L	89_N	1.447	1.00
80_S	84_M	1.419	1.00
37_E	68_I	1.391	1.00
129_M	147_H	1.360	1.00
107_G	144_K	1.346	1.00
184_V	198_V	1.333	1.00
142_V	146_C	1.329	1.00
101_R	104_V	1.311	1.00
16_S	50_V	1.279	1.00
157_V	184_V	1.263	1.00
168_I	172_V	1.261	1.00
37_E	63_E	1.254	1.00
35_F	39_A	1.251	1.00
142_V	154_L	1.248	1.00
183_G	200_N	1.242	1.00
113_M	129_M	1.225	1.00
61_I	65_Q	1.224	1.00
154_L	157_V	1.220	1.00
106_I	124_I	1.217	1.00
37_E	40_K	1.215	1.00
29_E	55_S	1.212	1.00
33_I	59_T	1.204	1.00
149_G	173_V	1.196	1.00
45_G	57_I	1.191	1.00
72_V	96_P	1.186	1.00
178_A	192_V	1.183	1.00
47_T	54_W	1.174	1.00
100_I	104_V	1.152	1.00
106_I	110_A	1.137	1.00
172_V	187_G	1.118	1.00
121_G	139_R	1.109	1.00
79_N	83_P	1.092	1.00
101_R	119_N	1.092	1.00
168_I	180_V	1.084	1.00
76_D	79_N	1.071	1.00
75_N	79_N	1.067	1.00
113_M	119_N	1.064	1.00
27_K	31_E	1.053	1.00
151_G	177_N	1.052	1.00
186_V	198_V	1.050	1.00
128_T	146_C	1.047	1.00
73_V	76_D	1.027	1.00
19_S	22_V	1.020	0.99
192_V	198_V	1.019	0.99
138_G	155_A	1.013	0.99
119_N	135_V	1.012	0.99
147_H	173_V	0.999	0.99
71_Y	75_N	0.986	0.99
107_G	128_T	0.985	0.99
40_K	44_N	0.978	0.99
136_L	148_I	0.974	0.99
34_N	37_E	0.972	0.99
111_V	129_M	0.968	0.99
193_A	199_V	0.948	0.99
83_P	87_L	0.948	0.99
91_K	108_D	0.948	0.99
63_E	68_I	0.945	0.99
172_V	190_A	0.945	0.99
40_K	43_I	0.939	0.99
82_I	85_L	0.939	0.99
152_S	157_V	0.933	0.99
75_N	78_R	0.930	0.99
116_A	132_M	0.927	0.99
125_G	170_D	0.924	0.99
13_I	20_T	0.923	0.99
71_Y	74_E	0.911	0.99
74_E	78_R	0.905	0.99
110_A	125_G	0.899	0.99
77_R	80_S	0.897	0.99
45_G	48_G	0.889	0.99
154_L	168_I	0.888	0.99
146_C	170_D	0.885	0.99
139_R	155_A	0.873	0.98
93_R	98_A	0.860	0.98
151_G	156_G	0.856	0.98
17_T	51_F	0.855	0.98
105_E	121_G	0.855	0.98
143_G	167_V	0.854	0.98
146_C	169_E	0.845	0.98
148_I	152_S	0.845	0.98
152_S	174_I	0.843	0.98
112_I	116_A	0.841	0.98
124_I	130_I	0.833	0.98
153_V	177_N	0.821	0.98
100_I	112_I	0.807	0.97
82_I	86_D	0.806	0.97
131_D	147_H	0.802	0.97
97_G	117_S	0.800	0.97
180_V	192_V	0.796	0.97
82_I	100_I	0.790	0.97
128_T	170_D	0.790	0.97
85_L	88_K	0.788	0.97
94_I	113_M	0.786	0.97
107_G	110_A	0.786	0.97
173_V	191_V	0.769	0.96
124_I	128_T	0.760	0.96
78_R	82_I	0.759	0.96
169_E	187_G	0.757	0.96
128_T	144_K	0.754	0.96
194_A	199_V	0.751	0.96
168_I	174_I	0.749	0.96
41_A	59_T	0.742	0.96
64_N	70_D	0.732	0.95
11_S	61_I	0.730	0.95
133_N	150_A	0.728	0.95
127_G	144_K	0.727	0.95
151_G	154_L	0.723	0.95
93_R	100_I	0.721	0.95
73_V	77_R	0.718	0.95
73_V	84_M	0.713	0.95
135_V	150_A	0.709	0.94
91_K	106_I	0.705	0.94
185_T	188_K	0.704	0.94
44_N	48_G	0.704	0.94
8_E	69_E	0.697	0.94
99_I	115_G	0.694	0.94
37_E	60_A	0.691	0.94
39_A	43_I	0.691	0.94
128_T	143_G	0.690	0.94
10_I	64_N	0.689	0.94
117_S	132_M	0.688	0.94
55_S	58_Q	0.687	0.94
74_E	83_P	0.687	0.94
60_A	64_N	0.683	0.93
130_I	134_V	0.680	0.93
121_G	141_T	0.680	0.93
146_C	168_I	0.678	0.93
79_N	82_I	0.673	0.93
153_V	156_G	0.672	0.93
143_G	188_K	0.671	0.93
157_V	183_G	0.669	0.93
110_A	126_E	0.667	0.92
35_F	38_S	0.665	0.92
72_V	76_D	0.662	0.92
45_G	62_E	0.660	0.92
180_V	184_V	0.659	0.92
75_N	83_P	0.658	0.92
176_A	181_L	0.657	0.92
143_G	146_C	0.651	0.92
67_K	70_D	0.650	0.92
92_A	109_N	0.648	0.91
20_T	23_K	0.648	0.91
53_E	57_I	0.646	0.91
17_T	50_V	0.646	0.91
172_V	188_K	0.644	0.91
78_R	81_A	0.643	0.91
133_N	153_V	0.643	0.91
26_V	65_Q	0.641	0.91
97_G	115_G	0.638	0.91
145_N	170_D	0.636	0.91
169_E	190_A	0.634	0.90
28_G	31_E	0.632	0.90
125_G	128_T	0.628	0.90
49_V	55_S	0.627	0.90
36_G	40_K	0.622	0.90
53_E	58_Q	0.620	0.89
146_C	174_I	0.610	0.89
180_V	186_V	0.607	0.89
117_S	135_V	0.606	0.88
177_N	195_G	0.603	0.88
187_G	190_A	0.602	0.88
151_G	157_V	0.598	0.88
32_G	38_S	0.598	0.88
6_A	10_I	0.598	0.88
149_G	153_V	0.597	0.88
123_V	126_E	0.597	0.88
94_I	114_M	0.594	0.87
104_V	122_S	0.592	0.87
94_I	98_A	0.591	0.87
78_R	83_P	0.591	0.87
143_G	169_E	0.590	0.87
93_R	112_I	0.588	0.87
44_N	62_E	0.586	0.87
135_V	149_G	0.584	0.87
37_E	41_A	0.583	0.86
86_D	90_I	0.579	0.86
103_Q	120_I	0.578	0.86
16_S	51_F	0.578	0.86
176_A	199_V	0.577	0.86
140_A	157_V	0.577	0.86
194_A	197_I	0.576	0.86
123_V	144_K	0.576	0.86
181_L	199_V	0.574	0.86
179_V	183_G	0.571	0.85
29_E	32_G	0.569	0.85
87_L	90_I	0.569	0.85
11_S	15_N	0.568	0.85
92_A	111_V	0.560	0.84
89_N	106_I	0.560	0.84
130_I	148_I	0.557	0.84
12_F	57_I	0.554	0.84
32_G	128_T	0.554	0.84
142_V	168_I	0.551	0.83
113_M	116_A	0.551	0.83
8_E	64_N	0.549	0.83
120_I	139_R	0.548	0.83
77_R	81_A	0.548	0.83
100_I	106_I	0.547	0.83
74_E	79_N	0.546	0.83
116_A	133_N	0.546	0.83
33_I	37_E	0.543	0.82
135_V	153_V	0.543	0.82
105_E	141_T	0.542	0.82
152_S	156_G	0.535	0.81
61_I	64_N	0.535	0.81
148_I	174_I	0.534	0.81
183_G	186_V	0.534	0.81
38_S	42_F	0.528	0.81
112_I	130_I	0.528	0.81
73_V	78_R	0.526	0.80
43_I	46_N	0.525	0.80
178_A	181_L	0.523	0.80
44_N	65_Q	0.522	0.80
101_R	122_S	0.521	0.80
98_A	118_I	0.521	0.80
14_Q	17_T	0.518	0.79
134_V	152_S	0.517	0.79
181_L	197_I	0.517	0.79
86_D	91_K	0.516	0.79
61_I	68_I	0.516	0.79
17_T	55_S	0.516	0.79
95_E	99_I	0.510	0.78
17_T	49_V	0.509	0.78
58_Q	62_E	0.508	0.78
150_A	153_V	0.508	0.78
38_S	56_E	0.507	0.78
29_E	58_Q	0.505	0.78
140_A	153_V	0.503	0.77
28_G	32_G	0.502	0.77
76_D	83_P	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4g3qA	3	0.9958	100	0.458	Contact Map
3r8yA	3	0.7881	100	0.467	Contact Map
1hm9A	3	0.9788	100	0.473	Contact Map
3tk8A	3	0.8051	100	0.475	Contact Map
2v0hA	3	0.9364	100	0.484	Contact Map
4fceA	3	0.9195	100	0.502	Contact Map
3gosA	3	0.9915	100	0.505	Contact Map
2iu8A	3	0.9831	100	0.512	Contact Map
3eg4A	3	0.9661	100	0.516	Contact Map
4hzdA	5	0.8771	100	0.522	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.