YOAZ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOAZ - Uncharacterized protease YoaZ

UniProt:	O34947	Sequences: MQTRKVYLYVFHTMSDWEYGYLIAELNSGRYFKQDAASLKVVTVGVNKEMITTLGGLSIKPDISLDECTLGSQDLIILPGGNTWGEDIHQPILKKVGDALKLGTTIAAICGATLGLANEGYLNSRKHTSNDLDYMNMVCPNYKGETFYEKGPAVSDENLVTASGIAPLEFAVEVLKKLDVFAPDTLRSWYKLNKTQKPEYFFELMNTINR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	210 (176)
Sequences:	14962 (9886)
Seq/√Len:	745.2

ECOLI - YAJL YHBO
BACSU - YOAZ YDEA YRAA GS18
HALSA - Q9HMG4
SULSO - Q97Z65

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
155_S	177_K	2.929	1.00
5_K	40_K	2.920	1.00
7_Y	73_Q	2.801	1.00
50_M	60_K	2.794	1.00
7_Y	44_V	2.630	1.00
173_E	176_K	2.527	1.00
42_V	73_Q	2.407	1.00
125_R	157_E	2.401	1.00
5_K	42_V	2.298	1.00
125_R	156_D	2.275	1.00
123_N	144_G	2.250	1.00
122_L	127_H	2.180	1.00
42_V	63_I	2.133	1.00
181_F	185_T	2.007	1.00
155_S	173_E	1.969	1.00
25_E	175_L	1.967	1.00
100_L	158_N	1.828	1.00
14_M	53_T	1.822	1.00
125_R	159_L	1.772	1.00
23_I	27_N	1.730	1.00
152_P	169_E	1.721	1.00
29_G	175_L	1.701	1.00
45_G	48_K	1.667	1.00
50_M	58_S	1.666	1.00
100_L	106_I	1.664	1.00
176_K	181_F	1.660	1.00
126_K	148_Y	1.595	1.00
126_K	156_D	1.590	1.00
99_A	104_T	1.584	1.00
52_T	58_S	1.577	1.00
108_A	161_T	1.576	1.00
46_V	89_H	1.558	1.00
105_T	177_K	1.529	1.00
155_S	160_V	1.525	1.00
183_P	186_L	1.519	1.00
93_L	97_G	1.477	1.00
64_S	67_E	1.470	1.00
125_R	158_N	1.428	1.00
179_D	183_P	1.414	1.00
39_L	178_L	1.404	1.00
107_A	174_V	1.401	1.00
138_V	147_F	1.400	1.00
126_K	147_F	1.391	1.00
8_L	23_I	1.370	1.00
16_D	20_G	1.362	1.00
8_L	77_I	1.358	1.00
94_K	98_D	1.358	1.00
66_D	91_P	1.345	1.00
75_L	105_T	1.342	1.00
58_S	62_D	1.337	1.00
98_D	102_L	1.324	1.00
95_K	99_A	1.323	1.00
160_V	177_K	1.315	1.00
6_V	75_L	1.311	1.00
173_E	177_K	1.307	1.00
10_V	43_T	1.301	1.00
108_A	116_L	1.301	1.00
12_H	52_T	1.294	1.00
94_K	97_G	1.279	1.00
90_Q	94_K	1.277	1.00
25_E	191_K	1.273	1.00
100_L	159_L	1.246	1.00
100_L	121_Y	1.234	1.00
107_A	170_F	1.233	1.00
63_I	67_E	1.227	1.00
117_A	145_E	1.225	1.00
127_H	145_E	1.222	1.00
14_M	19_Y	1.197	1.00
139_C	149_E	1.182	1.00
39_L	179_D	1.177	1.00
26_L	171_A	1.174	1.00
103_G	106_I	1.173	1.00
126_K	146_T	1.166	1.00
180_V	183_P	1.157	1.00
23_I	43_T	1.148	1.00
103_G	158_N	1.142	1.00
48_K	64_S	1.134	1.00
155_S	158_N	1.129	1.00
136_N	141_N	1.129	1.00
93_L	119_E	1.125	1.00
120_G	123_N	1.124	1.00
114_L	136_N	1.124	1.00
91_P	94_K	1.104	1.00
9_Y	92_I	1.104	1.00
126_K	149_E	1.102	1.00
19_Y	43_T	1.097	1.00
16_D	57_L	1.095	1.00
105_T	178_L	1.089	1.00
17_W	21_Y	1.075	1.00
126_K	154_V	1.074	1.00
77_I	170_F	1.073	1.00
74_D	104_T	1.070	1.00
24_A	28_S	1.062	1.00
21_Y	168_L	1.049	1.00
10_V	19_Y	1.036	1.00
14_M	59_I	1.026	1.00
153_A	173_E	1.013	1.00
126_K	151_G	1.012	1.00
21_Y	24_A	0.999	1.00
8_L	41_V	0.994	1.00
88_I	118_N	0.988	1.00
100_L	103_G	0.985	1.00
111_G	133_D	0.980	1.00
46_V	91_P	0.979	1.00
97_G	101_K	0.975	1.00
130_N	164_G	0.975	1.00
21_Y	171_A	0.974	1.00
98_D	101_K	0.973	1.00
118_N	141_N	0.973	1.00
44_V	63_I	0.970	1.00
78_L	96_V	0.969	1.00
184_D	188_S	0.968	1.00
39_L	175_L	0.955	1.00
151_G	169_E	0.950	1.00
134_Y	142_Y	0.946	1.00
50_M	61_P	0.936	1.00
76_I	99_A	0.921	1.00
113_T	129_S	0.915	1.00
105_T	158_N	0.914	1.00
70_L	98_D	0.902	1.00
162_A	170_F	0.901	1.00
24_A	27_N	0.898	1.00
45_G	61_P	0.892	1.00
142_Y	145_E	0.890	1.00
128_T	154_V	0.889	1.00
42_V	62_D	0.888	1.00
99_A	102_L	0.887	1.00
160_V	170_F	0.881	1.00
25_E	171_A	0.881	1.00
44_V	68_C	0.880	1.00
185_T	189_W	0.876	1.00
182_A	186_L	0.875	1.00
160_V	174_V	0.867	1.00
108_A	113_T	0.861	1.00
46_V	65_L	0.860	1.00
75_L	178_L	0.859	1.00
22_L	77_I	0.850	1.00
10_V	14_M	0.848	1.00
63_I	68_C	0.841	1.00
87_D	118_N	0.829	1.00
97_G	119_E	0.824	1.00
77_I	107_A	0.822	1.00
132_L	190_Y	0.821	1.00
78_L	112_A	0.821	1.00
105_T	160_V	0.820	1.00
21_Y	167_P	0.815	1.00
149_E	154_V	0.815	1.00
83_T	86_E	0.810	1.00
12_H	47_N	0.809	1.00
6_V	39_L	0.799	1.00
16_D	55_G	0.798	1.00
93_L	118_N	0.796	1.00
73_Q	99_A	0.795	1.00
7_Y	68_C	0.785	1.00
38_S	179_D	0.769	1.00
160_V	173_E	0.765	1.00
109_I	167_P	0.765	1.00
141_N	146_T	0.764	1.00
6_V	26_L	0.758	1.00
16_D	53_T	0.756	1.00
93_L	96_V	0.754	1.00
19_Y	23_I	0.752	1.00
134_Y	149_E	0.752	1.00
175_L	187_R	0.750	1.00
176_K	184_D	0.750	1.00
118_N	142_Y	0.749	1.00
95_K	98_D	0.738	1.00
136_N	140_P	0.730	1.00
123_N	145_E	0.724	1.00
165_I	191_K	0.724	1.00
22_L	167_P	0.723	1.00
23_I	41_V	0.715	1.00
167_P	171_A	0.712	1.00
8_L	22_L	0.711	1.00
78_L	115_G	0.708	1.00
8_L	19_Y	0.707	1.00
89_H	92_I	0.707	1.00
48_K	61_P	0.702	1.00
134_Y	139_C	0.701	1.00
69_T	98_D	0.693	1.00
100_L	125_R	0.692	1.00
172_V	188_S	0.692	1.00
75_L	107_A	0.690	1.00
70_L	102_L	0.689	1.00
28_S	191_K	0.685	1.00
14_M	79_P	0.668	1.00
135_M	140_P	0.666	1.00
168_L	172_V	0.661	1.00
106_I	158_N	0.657	1.00
63_I	69_T	0.653	1.00
78_L	92_I	0.652	1.00
49_E	61_P	0.651	1.00
25_E	28_S	0.650	1.00
39_L	75_L	0.650	1.00
9_Y	76_I	0.647	1.00
96_V	115_G	0.646	1.00
133_D	136_N	0.644	1.00
26_L	174_V	0.638	1.00
186_L	190_Y	0.633	1.00
131_D	164_G	0.632	1.00
182_A	185_T	0.629	1.00
117_A	122_L	0.627	1.00
5_K	74_D	0.619	1.00
108_A	112_A	0.619	1.00
75_L	174_V	0.619	1.00
48_K	67_E	0.610	1.00
26_L	39_L	0.610	1.00
15_S	24_A	0.609	1.00
138_V	142_Y	0.609	1.00
73_Q	76_I	0.604	1.00
7_Y	42_V	0.602	1.00
105_T	174_V	0.598	1.00
28_S	190_Y	0.593	1.00
23_I	57_L	0.591	1.00
93_L	115_G	0.591	1.00
27_N	41_V	0.584	1.00
116_L	119_E	0.582	1.00
97_G	121_Y	0.579	1.00
148_Y	151_G	0.576	1.00
129_S	148_Y	0.575	1.00
49_E	60_K	0.573	1.00
44_V	73_Q	0.562	1.00
96_V	121_Y	0.562	1.00
183_P	187_R	0.561	1.00
25_E	172_V	0.560	1.00
68_C	73_Q	0.551	1.00
90_Q	93_L	0.548	1.00
10_V	51_I	0.546	1.00
122_L	161_T	0.545	1.00
127_H	146_T	0.541	1.00
109_I	170_F	0.540	1.00
88_I	93_L	0.539	1.00
38_S	183_P	0.536	1.00
147_F	150_K	0.535	1.00
114_L	133_D	0.529	1.00
9_Y	44_V	0.529	1.00
39_L	74_D	0.529	1.00
169_E	172_V	0.526	1.00
106_I	121_Y	0.525	1.00
152_P	163_S	0.523	1.00
13_T	52_T	0.523	1.00
96_V	119_E	0.523	1.00
82_N	85_G	0.521	1.00
106_I	159_L	0.519	1.00
130_N	165_I	0.518	1.00
151_G	154_V	0.518	1.00
107_A	160_V	0.517	1.00
22_L	26_L	0.514	1.00
90_Q	97_G	0.510	1.00
106_I	116_L	0.509	1.00
7_Y	95_K	0.508	1.00
25_E	29_G	0.508	1.00
82_N	86_E	0.508	1.00
29_G	183_P	0.508	1.00
52_T	56_G	0.507	1.00
124_S	144_G	0.506	1.00
68_C	95_K	0.505	1.00
15_S	54_L	0.504	1.00
22_L	171_A	0.502	1.00
18_E	80_G	0.502	1.00
25_E	168_L	0.501	1.00
76_I	95_K	0.501	1.00
158_N	177_K	0.500	1.00
117_A	143_K	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3efeA	2	0.9762	100	0.183	Contact Map
3er6A	2	0.919	100	0.191	Contact Map
3mgkA	2	0.9429	100	0.194	Contact Map
3graA	2	0.8762	100	0.2	Contact Map
2rk3A	2	0.8667	100	0.238	Contact Map
3ewnA	2	0.9429	100	0.239	Contact Map
3noqA	2	0.9333	100	0.245	Contact Map
3bhnA	2	0.9143	100	0.255	Contact Map
4e08A	2	0.8667	100	0.255	Contact Map
3fseA	2	0.9333	100	0.27	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.