YOAJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOAJ - Expansin-YoaJ

UniProt:	O34918	Sequences: MKKIMSAFVGMVLLTIFCFSPQASAAYDDLHEGYATYTGSGYSGGAFLLDPIPSDMEITAINPADLNYGGVKAALAGSYLEVEGPKGKTTVYVTDLYPEGARGALDLSPNAFRKIGNMKDGKINIKWRVVKAPITGNFTYRIKEGSSRWWAAIQVRNHKYPVMKMEYEKDGKWINMEKMDYNHFVSTNLGTGSLKVRMTDIRGKVVKDTIPKLPESGTSKAYTVPGHVQFPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	232 (210)
Sequences:	1633 (926)
Seq/√Len:	63.9

BACSU - YOAJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
97_Y	100_G	5.218	1.00
81_E	128_R	4.717	1.00
166_E	197_R	4.538	1.00
155_V	165_M	4.147	1.00
79_Y	132_A	3.578	1.00
138_F	206_V	3.240	1.00
90_T	130_V	2.701	1.00
46_A	96_L	2.498	1.00
199_T	205_V	2.455	1.00
34_Y	122_K	2.323	1.00
153_I	196_V	2.292	1.00
138_F	208_D	2.270	1.00
78_S	161_P	2.254	1.00
47_F	76_A	2.101	1.00
74_A	178_K	2.091	1.00
83_E	126_K	2.082	1.00
59_T	93_V	2.051	1.00
81_E	90_T	2.043	1.00
116_G	123_I	2.011	1.00
59_T	91_V	1.911	1.00
98_P	106_D	1.904	1.00
82_V	105_L	1.892	1.00
63_P	96_L	1.848	1.00
81_E	88_K	1.827	1.00
60_A	106_D	1.819	1.00
115_I	123_I	1.750	1.00
226_G	229_Q	1.736	0.99
140_Y	208_D	1.731	0.99
63_P	99_E	1.690	0.99
109_P	118_M	1.661	0.99
152_A	185_V	1.649	0.99
75_L	78_S	1.644	0.99
106_D	121_G	1.585	0.99
14_L	19_F	1.559	0.99
60_A	98_P	1.523	0.99
38_T	106_D	1.518	0.99
80_L	91_V	1.509	0.99
80_L	127_W	1.503	0.98
36_T	106_D	1.483	0.98
76_A	79_Y	1.467	0.98
46_A	66_L	1.464	0.98
173_W	197_R	1.434	0.98
80_L	105_L	1.433	0.98
162_V	198_M	1.431	0.98
165_M	184_F	1.418	0.98
143_K	150_W	1.399	0.98
197_R	207_K	1.386	0.97
96_L	99_E	1.371	0.97
112_F	120_D	1.359	0.97
203_G	229_Q	1.357	0.97
152_A	183_H	1.355	0.97
43_S	52_I	1.351	0.97
217_G	229_Q	1.336	0.97
51_P	54_S	1.325	0.97
170_D	193_S	1.301	0.96
173_W	195_K	1.282	0.96
177_E	185_V	1.273	0.96
15_T	20_S	1.272	0.96
58_I	95_D	1.272	0.96
37_Y	118_M	1.259	0.95
83_E	88_K	1.256	0.95
58_I	108_S	1.244	0.95
15_T	18_C	1.240	0.95
87_G	115_I	1.231	0.95
129_V	161_P	1.228	0.95
36_T	39_G	1.227	0.95
38_T	60_A	1.223	0.95
72_K	96_L	1.210	0.94
161_P	201_I	1.209	0.94
76_A	97_Y	1.205	0.94
103_G	127_W	1.195	0.94
76_A	132_A	1.194	0.94
162_V	165_M	1.194	0.94
213_L	216_S	1.170	0.93
13_L	16_I	1.167	0.93
19_F	22_Q	1.164	0.93
166_E	199_T	1.163	0.93
179_M	185_V	1.162	0.93
47_F	79_Y	1.157	0.93
19_F	23_A	1.157	0.93
12_V	17_F	1.156	0.93
16_I	19_F	1.156	0.93
112_F	116_G	1.146	0.93
112_F	117_N	1.145	0.93
57_E	114_K	1.132	0.92
142_I	153_I	1.126	0.92
38_T	121_G	1.113	0.91
12_V	15_T	1.111	0.91
35_A	104_A	1.101	0.91
35_A	125_I	1.100	0.91
39_G	42_Y	1.095	0.91
62_N	65_D	1.089	0.90
25_A	28_D	1.088	0.90
182_N	226_G	1.081	0.90
21_P	25_A	1.071	0.90
107_L	112_F	1.070	0.90
84_G	87_G	1.057	0.89
48_L	181_Y	1.053	0.89
65_D	105_L	1.051	0.89
49_L	63_P	1.050	0.89
88_K	126_K	1.022	0.87
80_L	129_V	1.020	0.87
64_A	99_E	1.014	0.87
165_M	197_R	1.004	0.87
13_L	21_P	1.003	0.86
89_T	115_I	0.999	0.86
40_S	58_I	0.997	0.86
152_A	179_M	0.990	0.86
20_S	23_A	0.980	0.85
31_H	103_G	0.976	0.85
61_I	93_V	0.972	0.85
22_Q	26_A	0.971	0.85
197_R	205_V	0.970	0.85
113_R	118_M	0.969	0.85
89_T	107_L	0.967	0.84
141_R	156_R	0.967	0.84
26_A	229_Q	0.961	0.84
47_F	97_Y	0.952	0.83
17_F	22_Q	0.944	0.83
147_S	151_A	0.943	0.83
208_D	226_G	0.939	0.83
12_V	16_I	0.930	0.82
23_A	26_A	0.924	0.82
85_P	126_K	0.919	0.81
39_G	109_P	0.916	0.81
39_G	44_G	0.915	0.81
80_L	93_V	0.913	0.81
166_E	175_N	0.910	0.81
64_A	125_I	0.909	0.81
47_F	132_A	0.907	0.80
79_Y	200_D	0.903	0.80
14_L	20_S	0.899	0.80
143_K	183_H	0.899	0.80
165_M	176_M	0.896	0.80
57_E	111_A	0.895	0.79
84_G	94_T	0.886	0.79
76_A	100_G	0.879	0.78
166_E	173_W	0.879	0.78
14_L	17_F	0.875	0.78
14_L	18_C	0.873	0.78
14_L	21_P	0.869	0.77
37_Y	121_G	0.869	0.77
18_C	22_Q	0.869	0.77
35_A	94_T	0.867	0.77
66_L	195_K	0.867	0.77
161_P	182_N	0.860	0.77
109_P	113_R	0.858	0.77
154_Q	184_F	0.854	0.76
167_Y	174_I	0.854	0.76
200_D	204_K	0.848	0.76
31_H	127_W	0.846	0.76
91_V	115_I	0.844	0.75
160_Y	200_D	0.843	0.75
92_Y	157_N	0.842	0.75
32_E	126_K	0.836	0.75
89_T	114_K	0.826	0.74
16_I	20_S	0.816	0.73
174_I	207_K	0.814	0.73
36_T	60_A	0.813	0.73
23_A	27_Y	0.810	0.72
176_M	196_V	0.802	0.72
32_E	165_M	0.799	0.71
86_K	107_L	0.790	0.70
78_S	204_K	0.788	0.70
176_M	184_F	0.786	0.70
66_L	184_F	0.785	0.70
35_A	38_T	0.782	0.70
41_G	50_D	0.775	0.69
41_G	44_G	0.770	0.68
30_L	128_R	0.768	0.68
158_H	161_P	0.765	0.68
56_M	110_N	0.765	0.68
78_S	129_V	0.759	0.67
38_T	104_A	0.757	0.67
48_L	129_V	0.756	0.67
18_C	21_P	0.755	0.67
177_E	186_S	0.753	0.67
148_R	190_G	0.749	0.66
213_L	224_V	0.747	0.66
84_G	129_V	0.745	0.66
33_G	103_G	0.742	0.66
24_S	28_D	0.742	0.66
204_K	207_K	0.741	0.65
34_Y	104_A	0.724	0.64
17_F	21_P	0.724	0.64
63_P	214_P	0.718	0.63
21_P	24_S	0.715	0.63
166_E	207_K	0.711	0.62
104_A	122_K	0.708	0.62
36_T	104_A	0.705	0.62
147_S	229_Q	0.704	0.61
131_K	174_I	0.704	0.61
94_T	181_Y	0.693	0.60
143_K	167_Y	0.689	0.60
82_V	127_W	0.689	0.60
135_T	163_M	0.688	0.60
87_G	226_G	0.688	0.60
132_A	200_D	0.686	0.60
134_I	157_N	0.685	0.59
35_A	116_G	0.685	0.59
87_G	90_T	0.685	0.59
78_S	107_L	0.684	0.59
47_F	100_G	0.683	0.59
126_K	212_K	0.681	0.59
177_E	187_T	0.677	0.58
167_Y	194_L	0.676	0.58
19_F	25_A	0.673	0.58
66_L	82_V	0.673	0.58
79_Y	202_R	0.672	0.58
107_L	111_A	0.671	0.58
168_E	172_K	0.671	0.58
163_M	208_D	0.667	0.57
210_I	214_P	0.667	0.57
61_I	75_L	0.662	0.57
176_M	195_K	0.662	0.57
12_V	18_C	0.660	0.57
36_T	98_P	0.654	0.56
84_G	181_Y	0.653	0.56
133_P	155_V	0.652	0.56
112_F	115_I	0.650	0.55
79_Y	160_Y	0.650	0.55
137_N	198_M	0.648	0.55
40_S	108_S	0.646	0.55
154_Q	165_M	0.644	0.55
65_D	78_S	0.639	0.54
160_Y	202_R	0.639	0.54
171_G	190_G	0.636	0.54
73_A	216_S	0.634	0.54
58_I	61_I	0.632	0.53
104_A	160_Y	0.632	0.53
82_V	107_L	0.629	0.53
22_Q	27_Y	0.628	0.53
92_Y	134_I	0.627	0.53
105_L	127_W	0.626	0.53
132_A	160_Y	0.625	0.53
178_K	182_N	0.625	0.53
24_S	27_Y	0.624	0.52
168_E	195_K	0.620	0.52
16_I	23_A	0.620	0.52
165_M	227_H	0.620	0.52
116_G	120_D	0.620	0.52
188_N	207_K	0.619	0.52
136_G	157_N	0.615	0.51
41_G	60_A	0.614	0.51
35_A	61_I	0.614	0.51
12_V	19_F	0.612	0.51
27_Y	87_G	0.612	0.51
60_A	97_Y	0.610	0.51
12_V	25_A	0.610	0.51
90_T	215_E	0.608	0.51
13_L	19_F	0.608	0.51
35_A	107_L	0.608	0.51
83_E	205_V	0.601	0.50
67_N	74_A	0.601	0.50
134_I	137_N	0.600	0.50
40_S	44_G	0.597	0.49
20_S	24_S	0.594	0.49
22_Q	25_A	0.594	0.49
107_L	226_G	0.594	0.49
119_K	197_R	0.590	0.48
28_D	31_H	0.586	0.48
163_M	212_K	0.586	0.48
90_T	111_A	0.585	0.48
60_A	100_G	0.582	0.48
156_R	184_F	0.581	0.47
155_V	196_V	0.578	0.47
113_R	117_N	0.578	0.47
116_G	121_G	0.577	0.47
23_A	29_D	0.577	0.47
176_M	208_D	0.576	0.47
178_K	184_F	0.576	0.47
130_V	159_K	0.574	0.47
90_T	103_G	0.567	0.46
73_A	94_T	0.565	0.46
206_V	209_T	0.563	0.45
86_K	215_E	0.562	0.45
29_D	207_K	0.561	0.45
21_P	163_M	0.559	0.45
117_N	120_D	0.558	0.45
38_T	150_W	0.554	0.44
65_D	122_K	0.554	0.44
15_T	19_F	0.550	0.44
35_A	123_I	0.548	0.44
222_Y	226_G	0.548	0.44
147_S	190_G	0.546	0.43
18_C	24_S	0.545	0.43
13_L	17_F	0.538	0.43
26_A	29_D	0.537	0.42
150_W	185_V	0.536	0.42
162_V	194_L	0.535	0.42
57_E	91_V	0.533	0.42
81_E	112_F	0.533	0.42
95_D	144_E	0.532	0.42
147_S	150_W	0.532	0.42
142_I	151_A	0.531	0.42
13_L	20_S	0.531	0.42
128_R	153_I	0.531	0.42
78_S	131_K	0.528	0.41
17_F	25_A	0.528	0.41
199_T	207_K	0.523	0.41
39_G	106_D	0.522	0.41
225_P	229_Q	0.520	0.40
12_V	21_P	0.520	0.40
34_Y	102_R	0.518	0.40
196_V	212_K	0.516	0.40
35_A	82_V	0.515	0.40
199_T	206_V	0.514	0.40
43_S	101_A	0.511	0.39
143_K	154_Q	0.508	0.39
23_A	28_D	0.507	0.39
41_G	53_P	0.506	0.39
39_G	43_S	0.506	0.39
27_Y	128_R	0.506	0.39
131_K	159_K	0.504	0.39
21_P	27_Y	0.500	0.38

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3d30A	1	0.8621	100	0.218	Contact Map
4jcwA	2	0.8405	100	0.237	Contact Map
2hczX	1	0.9052	100	0.237	Contact Map
1n10A	1	0.875	100	0.27	Contact Map
1wc2A	1	0.5733	99.9	0.617	Contact Map
4pmkA	1	0.4871	99.9	0.676	Contact Map
4jp6A	1	0.4698	99.9	0.68	Contact Map
3ft1A	1	0.4052	99.8	0.687	Contact Map
4avrA	2	0.3879	99.8	0.705	Contact Map
2jnzA	1	0.4397	99.7	0.74	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.