HIS2 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIS2 - Histidine biosynthesis bifunctional protein HisIE

UniProt:	O34912	Sequences: MKQADELRFNEDGLIPAIVQDAASKEVLTLAYMNKESYEKTLETKETWFYSRSRQALWHKGETSGNTQAVKGIRYDCDQDALLVLVEPSGPACHTGSYSCFTKEQTEEQAADRFGIMNELERVIAERQAEMPEGAYTTYLFREGVDKILKKVGEEASEVIIAAKNRDHEELKWEAADLLYHLLVLLREQSLPLDDVLDVLKKRHSEIEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	209 (195)
Sequences:	1587 (910)
Seq/√Len:	65.2

ECOLI - HIS2
BACSU - HIS2
HALSA - HIS3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
41_T	70_V	4.463	1.00
137_T	180_Y	3.475	1.00
18_I	30_L	3.295	1.00
7_L	15_I	3.066	1.00
126_E	130_E	2.897	1.00
56_A	62_E	2.591	1.00
146_D	165_N	2.434	1.00
173_W	199_V	2.369	1.00
7_L	75_Y	2.316	1.00
48_W	59_H	2.250	1.00
50_Y	55_Q	2.187	1.00
47_T	84_V	2.176	1.00
46_E	59_H	2.167	1.00
69_A	89_S	2.120	1.00
71_K	87_E	2.116	1.00
67_T	89_S	2.108	1.00
172_K	199_V	2.087	1.00
40_K	43_E	2.029	1.00
146_D	164_K	2.015	1.00
88_P	91_P	2.012	1.00
8_R	11_E	1.994	1.00
39_E	43_E	1.991	1.00
69_A	87_E	1.987	1.00
35_K	39_E	1.987	1.00
17_A	33_M	1.981	1.00
30_L	81_A	1.946	1.00
199_V	202_K	1.908	1.00
121_E	187_R	1.874	1.00
26_E	98_Y	1.854	1.00
157_S	160_I	1.854	1.00
31_A	92_A	1.834	1.00
97_S	102_T	1.828	1.00
17_A	84_V	1.819	1.00
46_E	69_A	1.818	1.00
153_G	157_S	1.806	1.00
125_A	187_R	1.804	1.00
175_A	186_L	1.799	1.00
19_V	49_F	1.778	1.00
150_K	157_S	1.724	0.99
132_P	138_T	1.708	0.99
33_M	84_V	1.677	0.99
175_A	182_L	1.658	0.99
73_I	84_V	1.649	0.99
159_V	175_A	1.637	0.99
131_M	138_T	1.624	0.99
145_V	188_E	1.623	0.99
95_T	102_T	1.585	0.99
72_G	85_L	1.584	0.99
128_Q	187_R	1.561	0.99
46_E	67_T	1.558	0.99
179_L	182_L	1.443	0.98
17_A	37_S	1.441	0.98
47_T	70_V	1.439	0.98
171_L	191_L	1.434	0.98
40_K	48_W	1.413	0.98
25_K	85_L	1.412	0.98
40_K	57_L	1.400	0.98
56_A	63_T	1.379	0.97
159_V	178_L	1.373	0.97
176_A	196_V	1.339	0.97
168_H	191_L	1.338	0.97
49_F	88_P	1.326	0.97
59_H	62_E	1.323	0.97
144_G	148_I	1.315	0.97
175_A	179_L	1.284	0.96
168_H	195_D	1.259	0.96
138_T	142_R	1.247	0.95
131_M	134_G	1.199	0.94
29_T	81_A	1.177	0.94
22_A	71_K	1.168	0.94
40_K	44_T	1.164	0.93
159_V	182_L	1.159	0.93
66_N	88_P	1.153	0.93
128_Q	141_F	1.151	0.93
40_K	59_H	1.146	0.93
117_M	193_L	1.143	0.93
23_A	87_E	1.137	0.93
176_A	199_V	1.135	0.93
163_A	185_L	1.135	0.93
162_A	170_E	1.113	0.92
29_T	83_L	1.104	0.91
16_P	30_L	1.102	0.91
137_T	184_V	1.099	0.91
139_Y	147_K	1.081	0.91
147_K	161_I	1.078	0.90
121_E	193_L	1.076	0.90
143_E	147_K	1.073	0.90
49_F	68_Q	1.065	0.90
34_N	37_S	1.059	0.90
70_V	101_F	1.053	0.89
166_R	189_Q	1.051	0.89
156_A	160_I	1.050	0.89
68_Q	92_A	1.045	0.89
180_Y	184_V	1.037	0.89
119_E	204_H	1.025	0.88
192_P	195_D	1.022	0.88
145_V	189_Q	1.019	0.88
124_I	141_F	1.015	0.88
168_H	189_Q	1.009	0.87
9_F	38_Y	1.008	0.87
116_I	204_H	1.002	0.87
198_D	201_K	0.985	0.86
153_G	160_I	0.967	0.85
125_A	129_A	0.958	0.84
38_Y	42_L	0.957	0.84
8_R	53_S	0.954	0.84
152_V	156_A	0.953	0.84
27_V	83_L	0.951	0.84
49_F	84_V	0.942	0.83
196_V	199_V	0.940	0.83
156_A	161_I	0.936	0.83
134_G	141_F	0.930	0.83
19_V	86_V	0.928	0.83
74_R	85_L	0.927	0.82
47_T	68_Q	0.924	0.82
162_A	171_L	0.919	0.82
44_T	48_W	0.916	0.82
46_E	62_E	0.913	0.81
68_Q	86_V	0.913	0.81
7_L	38_Y	0.912	0.81
19_V	47_T	0.912	0.81
47_T	86_V	0.905	0.81
45_K	69_A	0.900	0.81
19_V	84_V	0.896	0.80
68_Q	88_P	0.890	0.80
66_N	91_P	0.880	0.79
130_E	138_T	0.879	0.79
66_N	89_S	0.877	0.79
198_D	202_K	0.856	0.77
72_G	104_E	0.852	0.77
128_Q	190_S	0.847	0.76
15_I	82_L	0.845	0.76
9_F	15_I	0.843	0.76
50_Y	62_E	0.840	0.76
191_L	195_D	0.834	0.75
34_N	50_Y	0.825	0.74
183_L	193_L	0.822	0.74
134_G	142_R	0.813	0.73
145_V	163_A	0.811	0.73
140_L	184_V	0.810	0.73
163_A	171_L	0.804	0.73
117_M	183_L	0.795	0.72
167_D	170_E	0.795	0.72
31_A	47_T	0.792	0.71
113_R	194_D	0.788	0.71
50_Y	56_A	0.784	0.71
34_N	57_L	0.782	0.70
70_V	84_V	0.771	0.69
42_L	73_I	0.763	0.69
131_M	142_R	0.763	0.69
47_T	59_H	0.757	0.68
124_I	187_R	0.754	0.68
150_K	153_G	0.747	0.67
59_H	67_T	0.746	0.67
172_K	191_L	0.745	0.67
165_N	170_E	0.731	0.65
171_L	189_Q	0.724	0.64
190_S	197_L	0.723	0.64
124_I	183_L	0.722	0.64
153_G	161_I	0.717	0.64
149_L	157_S	0.710	0.63
141_F	148_I	0.708	0.63
118_N	122_R	0.703	0.62
199_V	203_R	0.701	0.62
88_P	98_Y	0.699	0.62
10_N	32_Y	0.697	0.62
166_R	170_E	0.696	0.61
123_V	204_H	0.696	0.61
194_D	201_K	0.694	0.61
118_N	121_E	0.687	0.60
139_Y	142_R	0.686	0.60
21_D	98_Y	0.684	0.60
168_H	172_K	0.684	0.60
145_V	156_A	0.683	0.60
121_E	192_P	0.682	0.60
159_V	196_V	0.680	0.60
128_Q	131_M	0.678	0.59
194_D	198_D	0.677	0.59
130_E	134_G	0.674	0.59
59_H	68_Q	0.673	0.59
147_K	157_S	0.673	0.59
148_I	188_E	0.672	0.59
70_V	73_I	0.668	0.58
134_G	138_T	0.666	0.58
54_R	63_T	0.664	0.58
47_T	92_A	0.661	0.57
139_Y	143_E	0.658	0.57
91_P	98_Y	0.654	0.57
47_T	73_I	0.653	0.57
31_A	68_Q	0.651	0.56
16_P	32_Y	0.647	0.56
195_D	198_D	0.644	0.56
194_D	197_L	0.643	0.55
16_P	81_A	0.642	0.55
193_L	197_L	0.639	0.55
57_L	90_G	0.638	0.55
152_V	178_L	0.636	0.55
161_I	165_N	0.635	0.54
146_D	170_E	0.631	0.54
39_E	169_E	0.630	0.54
145_V	164_K	0.627	0.54
114_F	197_L	0.627	0.54
178_L	193_L	0.626	0.53
67_T	71_K	0.625	0.53
22_A	87_E	0.623	0.53
172_K	195_D	0.623	0.53
139_Y	150_K	0.622	0.53
164_K	170_E	0.620	0.53
187_R	190_S	0.618	0.52
12_D	55_Q	0.617	0.52
10_N	13_G	0.615	0.52
44_T	59_H	0.611	0.52
146_D	161_I	0.608	0.51
145_V	171_L	0.606	0.51
18_I	83_L	0.605	0.51
37_S	47_T	0.604	0.51
32_Y	81_A	0.601	0.51
159_V	176_A	0.598	0.50
7_L	82_L	0.598	0.50
121_E	125_A	0.595	0.50
128_Q	138_T	0.594	0.50
145_V	165_N	0.591	0.49
135_A	138_T	0.589	0.49
42_L	45_K	0.589	0.49
12_D	104_E	0.586	0.49
123_V	141_F	0.583	0.48
113_R	201_K	0.582	0.48
17_A	49_F	0.579	0.48
21_D	24_S	0.579	0.48
18_I	27_V	0.577	0.48
126_E	131_M	0.575	0.47
60_K	94_H	0.572	0.47
37_S	41_T	0.570	0.47
170_E	173_W	0.567	0.47
31_A	54_R	0.566	0.46
21_D	87_E	0.565	0.46
48_W	57_L	0.563	0.46
24_S	98_Y	0.562	0.46
10_N	14_L	0.560	0.46
53_S	81_A	0.558	0.45
8_R	54_R	0.558	0.45
49_F	86_V	0.556	0.45
53_S	92_A	0.555	0.45
63_T	137_T	0.555	0.45
95_T	103_K	0.554	0.45
33_M	47_T	0.553	0.45
147_K	153_G	0.553	0.45
124_I	132_P	0.552	0.45
147_K	170_E	0.550	0.45
141_F	187_R	0.547	0.44
159_V	162_A	0.545	0.44
149_L	153_G	0.545	0.44
168_H	190_S	0.543	0.44
179_L	193_L	0.540	0.43
99_S	162_A	0.540	0.43
150_K	159_V	0.538	0.43
41_T	47_T	0.537	0.43
45_K	169_E	0.535	0.43
35_K	79_Q	0.532	0.42
31_A	59_H	0.532	0.42
33_M	37_S	0.531	0.42
17_A	25_K	0.531	0.42
29_T	88_P	0.530	0.42
62_E	122_R	0.529	0.42
144_G	188_E	0.528	0.42
10_N	35_K	0.524	0.42
171_L	196_V	0.523	0.41
145_V	149_L	0.521	0.41
26_E	105_Q	0.521	0.41
29_T	58_W	0.520	0.41
166_R	188_E	0.520	0.41
149_L	164_K	0.517	0.41
114_F	180_Y	0.517	0.41
27_V	30_L	0.517	0.41
117_M	197_L	0.517	0.41
180_Y	185_L	0.516	0.41
172_K	179_L	0.515	0.41
172_K	176_A	0.515	0.41
149_L	160_I	0.514	0.40
138_T	141_F	0.513	0.40
124_I	178_L	0.511	0.40
139_Y	180_Y	0.511	0.40
146_D	150_K	0.510	0.40
66_N	130_E	0.510	0.40
139_Y	170_E	0.509	0.40
146_D	160_I	0.506	0.40
33_M	41_T	0.505	0.39
132_P	141_F	0.505	0.39
152_V	185_L	0.504	0.39
173_W	202_K	0.504	0.39
71_K	89_S	0.502	0.39
160_I	165_N	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zpsA	2	0.5837	100	0.429	Contact Map
2a7wA	4	0.4354	100	0.64	Contact Map
1yvwA	4	0.4402	100	0.647	Contact Map
1y6xA	3	0.4163	100	0.655	Contact Map
1yxbA	4	0.3971	100	0.659	Contact Map
2yxhA	2	0.4211	99.1	0.86	Contact Map
2gtaA	4	0.4211	98.6	0.882	Contact Map
1vmgA	4	0.3971	97.9	0.902	Contact Map
2oieA	3	0.4593	97.7	0.908	Contact Map
2q5zA	4	0.4115	97.5	0.911	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.