YFLB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YFLB - Uncharacterized protein YflB

UniProt:	O34887	Sequences: MDFSHIVSEDKIKRAIKDGDFQNLPGMGKPLPKDDAAHLPESLRMGYRILKNAGMAEDEGALKKELMTIDHLIEKCYDEKEREQLIRKKSEKQLLLDKLVDKKGMFSKPASAFYKNKVYDRLGRNRPSSS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	130 (119)
Sequences:	373 (279)
Seq/√Len:	25.6

ECOLI - YHDN
BACSU - YFLB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_D	48_R	6.233	1.00
46_G	49_I	3.481	1.00
34_D	37_A	3.383	1.00
43_L	72_L	3.209	1.00
16_I	21_F	3.123	1.00
58_D	61_A	2.891	1.00
56_A	60_G	2.857	1.00
61_A	64_K	2.787	1.00
7_V	10_D	2.211	0.97
15_A	20_D	2.027	0.96
14_R	69_I	1.981	0.95
93_Q	97_D	1.937	0.94
57_E	60_G	1.841	0.93
14_R	18_D	1.827	0.92
22_Q	27_M	1.815	0.92
92_K	96_L	1.813	0.92
56_A	73_I	1.765	0.91
21_F	76_C	1.656	0.88
21_F	53_A	1.642	0.87
43_L	47_Y	1.592	0.86
96_L	104_G	1.546	0.84
90_S	97_D	1.478	0.81
115_K	119_Y	1.447	0.80
13_K	17_K	1.440	0.79
47_Y	72_L	1.437	0.79
9_E	23_N	1.434	0.79
21_F	27_M	1.387	0.77
8_S	65_E	1.357	0.75
26_G	31_L	1.337	0.74
71_H	74_E	1.332	0.74
46_G	50_L	1.304	0.72
58_D	103_K	1.294	0.72
90_S	93_Q	1.251	0.69
18_D	27_M	1.249	0.69
4_S	90_S	1.203	0.66
30_P	76_C	1.195	0.65
10_D	14_R	1.187	0.65
7_V	11_K	1.156	0.63
79_E	82_R	1.155	0.63
61_A	65_E	1.149	0.62
39_L	57_E	1.142	0.62
37_A	40_P	1.121	0.60
10_D	13_K	1.118	0.60
60_G	64_K	1.117	0.60
31_L	35_D	1.114	0.60
37_A	60_G	1.099	0.59
47_Y	89_K	1.097	0.59
116_N	120_D	1.093	0.58
33_K	37_A	1.084	0.58
30_P	50_L	1.081	0.57
4_S	70_D	1.070	0.57
91_E	95_L	1.042	0.55
82_R	86_I	1.030	0.54
39_L	43_L	1.027	0.53
8_S	12_I	1.026	0.53
92_K	111_S	1.025	0.53
32_P	37_A	1.007	0.52
31_L	38_H	1.006	0.52
60_G	67_M	1.003	0.52
7_V	62_L	0.998	0.51
15_A	96_L	0.983	0.50
16_I	56_A	0.978	0.50
111_S	115_K	0.971	0.49
8_S	45_M	0.961	0.49
38_H	45_M	0.960	0.49
29_K	122_L	0.955	0.48
2_D	5_H	0.948	0.48
36_A	48_R	0.935	0.47
20_D	28_G	0.928	0.46
62_L	95_L	0.927	0.46
22_Q	115_K	0.905	0.45
119_Y	122_L	0.897	0.44
50_L	61_A	0.892	0.44
81_E	87_R	0.891	0.44
33_K	36_A	0.873	0.42
60_G	96_L	0.865	0.42
66_L	89_K	0.851	0.41
10_D	49_I	0.850	0.41
109_P	112_A	0.841	0.40
49_I	83_E	0.841	0.40
34_D	41_E	0.833	0.39
13_K	16_I	0.821	0.39
38_H	63_K	0.820	0.39
17_K	64_K	0.810	0.38
12_I	29_K	0.802	0.37
21_F	24_L	0.800	0.37
33_K	48_R	0.776	0.36
118_V	122_L	0.769	0.35
55_M	69_I	0.759	0.34
14_R	74_E	0.752	0.34
18_D	112_A	0.749	0.34
38_H	44_R	0.744	0.33
13_K	29_K	0.744	0.33
82_R	122_L	0.742	0.33
14_R	123_G	0.738	0.33
63_K	104_G	0.738	0.33
83_E	122_L	0.734	0.33
113_F	116_N	0.733	0.33
70_D	74_E	0.727	0.32
46_G	97_D	0.716	0.32
80_K	102_K	0.706	0.31
7_V	64_K	0.704	0.31
11_K	45_M	0.700	0.31
55_M	93_Q	0.687	0.30
74_E	121_R	0.683	0.30
88_K	116_N	0.683	0.30
87_R	96_L	0.683	0.30
110_A	113_F	0.675	0.29
107_S	110_A	0.675	0.29
4_S	29_K	0.675	0.29
46_G	111_S	0.675	0.29
14_R	121_R	0.670	0.29
7_V	90_S	0.663	0.28
26_G	30_P	0.662	0.28
34_D	73_I	0.660	0.28
63_K	110_A	0.660	0.28
18_D	29_K	0.658	0.28
35_D	52_N	0.658	0.28
23_N	80_K	0.652	0.28
8_S	63_K	0.652	0.28
20_D	117_K	0.648	0.27
7_V	50_L	0.647	0.27
35_D	39_L	0.643	0.27
64_K	106_F	0.638	0.27
45_M	122_L	0.633	0.27
59_E	89_K	0.625	0.26
34_D	39_L	0.622	0.26
46_G	77_Y	0.621	0.26
10_D	77_Y	0.621	0.26
113_F	117_K	0.619	0.26
37_A	48_R	0.618	0.26
3_F	14_R	0.617	0.26
15_A	87_R	0.614	0.26
83_E	86_I	0.614	0.26
93_Q	109_P	0.612	0.25
37_A	44_R	0.611	0.25
29_K	50_L	0.610	0.25
118_V	121_R	0.607	0.25
25_P	28_G	0.606	0.25
35_D	59_E	0.604	0.25
91_E	110_A	0.599	0.25
68_T	84_Q	0.598	0.25
18_D	30_P	0.591	0.24
5_H	93_Q	0.588	0.24
76_C	103_K	0.587	0.24
23_N	48_R	0.585	0.24
49_I	53_A	0.582	0.24
45_M	85_L	0.581	0.24
23_N	27_M	0.575	0.23
42_S	78_D	0.572	0.23
104_G	108_K	0.565	0.23
34_D	59_E	0.565	0.23
47_Y	121_R	0.565	0.23
85_L	113_F	0.562	0.23
109_P	113_F	0.561	0.23
97_D	117_K	0.552	0.22
58_D	108_K	0.551	0.22
43_L	94_L	0.551	0.22
24_L	28_G	0.550	0.22
20_D	67_M	0.549	0.22
5_H	11_K	0.547	0.22
42_S	63_K	0.545	0.22
74_E	119_Y	0.543	0.22
31_L	96_L	0.539	0.22
38_H	85_L	0.533	0.21
59_E	64_K	0.528	0.21
42_S	83_E	0.524	0.21
24_L	53_A	0.521	0.21
64_K	78_D	0.520	0.21
115_K	118_V	0.517	0.20
4_S	45_M	0.516	0.20
81_E	84_Q	0.514	0.20
4_S	7_V	0.512	0.20
76_C	92_K	0.512	0.20
91_E	94_L	0.509	0.20
9_E	105_M	0.509	0.20
13_K	123_G	0.506	0.20
34_D	122_L	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1bh9B	1	0.3308	31.7	0.935	Contact Map
4uxvA	1	0.9077	18.9	0.941	Contact Map
3uo3A	1	0.9615	18.7	0.941	Contact Map
3ca8A	1	0.4538	15.7	0.943	Contact Map
3g06A	1	0.8	10.8	0.947	Contact Map
3nl9A	2	0.4385	10	0.948	Contact Map
2xs1A	1	0.9462	8.7	0.949	Contact Map
1juqA	3	0.3923	8.6	0.95	Contact Map
1g6uA	3	0.3692	7.9	0.95	Contact Map
4h0eA	2	0.4769	7.8	0.951	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.