YTKC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTKC - Uncharacterized protein YtkC

UniProt:	O34883	Sequences: MDRDFGIFSFLAVSVSAAGFFFGGFQYSFLILLSLMAIEFISTTLKETIIHKLSFKKVFARLVKKLVTLALISVCHFFDQLLNTQGSIRDLAIMFYILYESVQIVVTASSLGIPVPQMLVDLLETLKNKFKRKP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	134 (124)
Sequences:	696 (555)
Seq/√Len:	49.8

BACSU - YTKC YQXH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_M	69_L	6.105	1.00
46_K	110_S	3.727	1.00
26_Q	89_R	3.365	1.00
50_I	110_S	2.785	1.00
58_V	99_Y	2.639	1.00
75_C	92_A	2.423	1.00
34_S	77_F	2.260	1.00
43_T	103_Q	2.174	1.00
38_I	70_A	2.138	1.00
109_S	126_L	2.132	1.00
55_F	103_Q	2.124	1.00
101_S	123_L	2.022	1.00
49_I	60_A	1.998	1.00
109_S	115_V	1.997	1.00
35_L	97_I	1.923	0.99
39_E	103_Q	1.908	0.99
39_E	43_T	1.890	0.99
117_Q	121_D	1.884	0.99
121_D	128_N	1.841	0.99
68_T	96_Y	1.824	0.99
62_L	99_Y	1.655	0.98
61_R	103_Q	1.619	0.98
43_T	55_F	1.603	0.98
44_T	102_V	1.543	0.97
67_V	108_A	1.475	0.96
101_S	125_T	1.427	0.95
7_I	11_L	1.401	0.95
65_K	100_E	1.400	0.95
39_E	61_R	1.398	0.95
39_E	55_F	1.379	0.94
104_I	111_L	1.346	0.94
32_L	72_I	1.334	0.93
39_E	106_V	1.332	0.93
43_T	61_R	1.324	0.93
14_S	128_N	1.322	0.93
49_I	112_G	1.304	0.93
13_V	16_S	1.302	0.93
103_Q	106_V	1.282	0.92
108_A	113_I	1.260	0.91
31_I	77_F	1.255	0.91
21_F	73_S	1.252	0.91
58_V	62_L	1.245	0.91
47_E	51_H	1.244	0.91
8_F	12_A	1.233	0.90
62_L	73_S	1.225	0.90
13_V	20_F	1.203	0.89
7_I	10_F	1.200	0.89
12_A	19_G	1.198	0.89
55_F	61_R	1.193	0.89
53_L	102_V	1.174	0.88
28_S	93_I	1.173	0.88
49_I	111_L	1.172	0.88
109_S	123_L	1.147	0.87
48_T	122_L	1.130	0.86
66_L	73_S	1.116	0.85
87_S	127_K	1.114	0.85
31_I	97_I	1.114	0.85
46_K	50_I	1.110	0.85
72_I	93_I	1.107	0.85
95_F	114_P	1.106	0.85
55_F	106_V	1.077	0.83
43_T	106_V	1.067	0.82
105_V	123_L	1.055	0.82
38_I	104_I	1.028	0.80
66_L	71_L	1.010	0.79
33_L	70_A	0.992	0.78
81_L	97_I	0.976	0.76
42_S	107_T	0.944	0.74
41_I	45_L	0.920	0.72
115_V	120_V	0.912	0.71
40_F	60_A	0.901	0.70
40_F	46_K	0.892	0.70
117_Q	120_V	0.865	0.67
35_L	78_F	0.861	0.67
14_S	21_F	0.860	0.67
120_V	124_E	0.859	0.67
22_F	26_Q	0.856	0.67
45_L	63_V	0.845	0.66
40_F	99_Y	0.824	0.64
16_S	19_G	0.822	0.63
30_L	34_S	0.794	0.61
67_V	127_K	0.785	0.60
54_S	124_E	0.783	0.60
29_F	33_L	0.777	0.59
31_I	35_L	0.767	0.58
61_R	106_V	0.766	0.58
67_V	111_L	0.761	0.57
105_V	119_L	0.757	0.57
64_K	74_V	0.752	0.56
59_F	68_T	0.751	0.56
18_A	22_F	0.747	0.56
98_L	101_S	0.745	0.56
37_A	41_I	0.737	0.55
27_Y	70_A	0.736	0.55
31_I	81_L	0.729	0.54
11_L	128_N	0.728	0.54
56_K	124_E	0.728	0.54
40_F	58_V	0.727	0.54
47_E	106_V	0.724	0.54
76_H	93_I	0.719	0.53
91_L	94_M	0.719	0.53
59_F	64_K	0.713	0.53
10_F	13_V	0.707	0.52
12_A	94_M	0.707	0.52
71_L	96_Y	0.707	0.52
19_G	94_M	0.705	0.52
105_V	115_V	0.705	0.52
49_I	63_V	0.704	0.52
36_M	56_K	0.693	0.50
10_F	20_F	0.692	0.50
76_H	80_Q	0.689	0.50
108_A	115_V	0.687	0.50
13_V	29_F	0.681	0.49
64_K	67_V	0.678	0.49
25_F	29_F	0.678	0.49
7_I	83_N	0.676	0.49
71_L	92_A	0.675	0.49
47_E	61_R	0.674	0.49
97_I	101_S	0.668	0.48
9_S	14_S	0.665	0.48
32_L	102_V	0.665	0.48
114_P	120_V	0.664	0.48
49_I	114_P	0.657	0.47
17_A	20_F	0.650	0.46
8_F	62_L	0.650	0.46
20_F	30_L	0.650	0.46
60_A	64_K	0.642	0.45
40_F	57_K	0.642	0.45
44_T	75_C	0.640	0.45
54_S	60_A	0.637	0.45
51_H	76_H	0.634	0.44
9_S	13_V	0.632	0.44
53_L	58_V	0.629	0.44
22_F	89_R	0.624	0.43
19_G	22_F	0.623	0.43
39_E	107_T	0.617	0.43
35_L	74_V	0.614	0.42
47_E	99_Y	0.609	0.42
9_S	12_A	0.608	0.42
37_A	69_L	0.603	0.41
7_I	14_S	0.601	0.41
40_F	44_T	0.600	0.41
35_L	101_S	0.599	0.41
7_I	67_V	0.598	0.41
51_H	125_T	0.598	0.41
94_M	98_L	0.596	0.41
42_S	57_K	0.583	0.39
22_F	29_F	0.583	0.39
62_L	66_L	0.582	0.39
64_K	68_T	0.576	0.39
64_K	96_Y	0.575	0.39
75_C	85_Q	0.571	0.38
48_T	53_L	0.571	0.38
78_F	101_S	0.570	0.38
44_T	48_T	0.569	0.38
40_F	89_R	0.569	0.38
76_H	115_V	0.564	0.38
103_Q	107_T	0.561	0.37
15_V	19_G	0.560	0.37
26_Q	125_T	0.554	0.37
74_V	101_S	0.554	0.37
28_S	94_M	0.552	0.36
24_G	89_R	0.551	0.36
20_F	95_F	0.550	0.36
44_T	51_H	0.545	0.36
35_L	113_I	0.545	0.36
46_K	63_V	0.543	0.36
61_R	107_T	0.541	0.35
118_M	130_F	0.540	0.35
57_K	124_E	0.536	0.35
81_L	113_I	0.534	0.35
20_F	51_H	0.532	0.35
26_Q	76_H	0.531	0.34
59_F	96_Y	0.531	0.34
66_L	78_F	0.530	0.34
8_F	16_S	0.526	0.34
10_F	38_I	0.522	0.34
65_K	79_D	0.519	0.33
117_Q	128_N	0.519	0.33
28_S	81_L	0.518	0.33
56_K	60_A	0.515	0.33
39_E	47_E	0.510	0.33
48_T	51_H	0.504	0.32
67_V	97_I	0.504	0.32
29_F	121_D	0.502	0.32
21_F	27_Y	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4dveA	3	0.4776	6.8	0.946	Contact Map
2ay0A	2	0.209	4.9	0.95	Contact Map
4me7E	2	0.209	4.5	0.951	Contact Map
1t6sA	4	0.4104	4.4	0.951	Contact Map
2izxA	2	0.1642	4.2	0.951	Contact Map
2m8eA	1	0.4179	3.9	0.952	Contact Map
3hrsA	2	0.3731	3.7	0.952	Contact Map
2k5jA	2	0.2463	3.5	0.953	Contact Map
1kvdA	1	0.4254	3.3	0.954	Contact Map
3d5pA	2	0.3731	3.2	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.