YOLI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOLI - Probable tautomerase YolI

UniProt:	O34882	Sequences: MPLLRFDVIEGRDEKSLQLLLDTAHQAMVEAFGVPERDRYQIVHQHPANELIIQDAGLGFQRTKDMVIISMTSKARTESQKEKLYALLAERLEKKCEISPDDLMVSITENGDADWSFGLGEAQFLNGKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	129 (125)
Sequences:	762 (557)
Seq/√Len:	49.8

BACSU - YOLI YRDN YUSQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_E	47_P	5.209	1.00
45_Q	50_E	3.890	1.00
63_T	102_D	3.222	1.00
25_H	29_V	2.696	1.00
89_A	103_L	2.515	1.00
84_L	88_L	2.439	1.00
4_L	24_A	2.220	1.00
5_R	70_S	2.214	1.00
88_L	105_V	2.177	1.00
11_G	45_Q	2.142	1.00
6_F	24_A	2.109	1.00
7_D	46_H	2.010	1.00
78_E	113_A	1.932	0.99
98_I	103_L	1.930	0.99
26_Q	91_R	1.885	0.99
3_L	42_I	1.855	0.99
20_L	67_V	1.848	0.99
77_T	80_Q	1.836	0.99
17_L	50_E	1.765	0.99
30_E	87_L	1.745	0.99
22_D	39_R	1.745	0.99
12_R	16_S	1.743	0.99
16_S	65_D	1.730	0.99
86_A	90_E	1.673	0.98
21_L	43_V	1.633	0.98
60_F	119_L	1.593	0.98
14_E	49_N	1.572	0.97
21_L	39_R	1.538	0.97
57_G	124_F	1.535	0.97
21_L	41_Q	1.528	0.97
8_V	17_L	1.524	0.97
87_L	91_R	1.497	0.96
82_E	125_L	1.483	0.96
26_Q	30_E	1.477	0.96
88_L	103_L	1.469	0.96
12_R	65_D	1.437	0.96
75_A	109_E	1.431	0.95
7_D	44_H	1.426	0.95
101_D	119_L	1.409	0.95
110_N	114_D	1.345	0.94
68_I	104_M	1.342	0.94
78_E	82_E	1.295	0.92
23_T	96_C	1.264	0.91
19_L	23_T	1.259	0.91
70_S	108_T	1.223	0.90
23_T	27_A	1.193	0.89
81_K	114_D	1.165	0.88
30_E	91_R	1.154	0.87
56_A	61_Q	1.130	0.86
74_K	121_E	1.124	0.86
31_A	87_L	1.112	0.85
18_Q	52_I	1.108	0.85
53_I	66_M	1.062	0.82
87_L	90_E	1.042	0.81
109_E	114_D	1.042	0.81
6_F	43_V	1.035	0.81
90_E	94_K	1.034	0.80
6_F	21_L	1.032	0.80
74_K	112_D	1.027	0.80
63_T	101_D	0.995	0.78
5_R	44_H	0.990	0.78
7_D	42_I	0.987	0.77
92_L	96_C	0.980	0.77
38_D	117_F	0.979	0.77
17_L	45_Q	0.968	0.76
26_Q	36_E	0.953	0.75
26_Q	94_K	0.932	0.73
72_T	85_Y	0.930	0.73
32_F	80_Q	0.922	0.72
83_K	86_A	0.922	0.72
66_M	104_M	0.919	0.72
54_Q	62_R	0.909	0.71
24_A	69_I	0.905	0.71
33_G	80_Q	0.899	0.70
11_G	16_S	0.888	0.69
23_T	95_K	0.886	0.69
51_L	66_M	0.867	0.68
116_S	120_G	0.865	0.67
34_V	84_L	0.861	0.67
7_D	106_S	0.857	0.67
23_T	91_R	0.849	0.66
93_E	99_S	0.847	0.66
99_S	102_D	0.845	0.66
8_V	43_V	0.837	0.65
37_R	54_Q	0.834	0.65
2_P	38_D	0.808	0.62
25_H	41_Q	0.808	0.62
46_H	50_E	0.806	0.62
93_E	100_P	0.805	0.62
48_A	64_K	0.803	0.62
60_F	101_D	0.801	0.61
89_A	105_V	0.797	0.61
24_A	43_V	0.796	0.61
54_Q	57_G	0.795	0.61
4_L	69_I	0.777	0.59
25_H	34_V	0.769	0.58
10_E	45_Q	0.763	0.58
6_F	69_I	0.756	0.57
90_E	100_P	0.746	0.56
27_A	34_V	0.745	0.56
29_V	37_R	0.728	0.54
69_I	75_A	0.724	0.54
85_Y	115_W	0.722	0.53
37_R	52_I	0.715	0.53
13_D	17_L	0.713	0.53
111_G	114_D	0.712	0.52
49_N	53_I	0.704	0.52
70_S	106_S	0.702	0.51
18_Q	22_D	0.697	0.51
83_K	87_L	0.696	0.51
27_A	88_L	0.695	0.51
14_E	47_P	0.693	0.51
19_L	96_C	0.691	0.50
85_Y	107_I	0.686	0.50
26_Q	95_K	0.683	0.49
17_L	20_L	0.680	0.49
69_I	92_L	0.679	0.49
15_K	26_Q	0.676	0.49
72_T	100_P	0.676	0.49
71_M	84_L	0.671	0.48
91_R	94_K	0.667	0.48
40_Y	104_M	0.660	0.47
19_L	95_K	0.651	0.46
20_L	92_L	0.639	0.45
65_D	90_E	0.632	0.44
16_S	96_C	0.630	0.44
74_K	111_G	0.627	0.44
20_L	98_I	0.626	0.44
3_L	73_S	0.625	0.44
14_E	94_K	0.622	0.43
23_T	69_I	0.622	0.43
14_E	83_K	0.616	0.43
13_D	16_S	0.611	0.42
28_M	40_Y	0.611	0.42
8_V	67_V	0.609	0.42
73_S	124_F	0.602	0.41
21_L	52_I	0.600	0.41
11_G	17_L	0.599	0.41
73_S	114_D	0.599	0.41
4_L	75_A	0.598	0.41
99_S	125_L	0.595	0.41
21_L	25_H	0.595	0.41
112_D	124_F	0.594	0.41
31_A	83_K	0.591	0.40
65_D	83_K	0.589	0.40
57_G	73_S	0.584	0.40
27_A	31_A	0.582	0.39
39_R	52_I	0.581	0.39
39_R	55_D	0.575	0.39
27_A	109_E	0.574	0.39
28_M	34_V	0.574	0.39
21_L	40_Y	0.571	0.38
73_S	84_L	0.570	0.38
61_Q	99_S	0.570	0.38
73_S	110_N	0.570	0.38
62_R	92_L	0.568	0.38
105_V	109_E	0.562	0.37
114_D	125_L	0.562	0.37
27_A	91_R	0.549	0.36
39_R	62_R	0.548	0.36
25_H	84_L	0.547	0.36
73_S	117_F	0.543	0.36
72_T	108_T	0.541	0.35
88_L	91_R	0.538	0.35
73_S	106_S	0.538	0.35
117_F	123_Q	0.537	0.35
79_S	90_E	0.533	0.35
9_I	64_K	0.530	0.34
32_F	56_A	0.530	0.34
71_M	76_R	0.530	0.34
42_I	46_H	0.526	0.34
48_A	95_K	0.526	0.34
58_L	124_F	0.526	0.34
46_H	70_S	0.522	0.34
91_R	95_K	0.521	0.34
10_E	50_E	0.521	0.34
82_E	114_D	0.518	0.33
16_S	20_L	0.515	0.33
21_L	73_S	0.515	0.33
29_V	41_Q	0.514	0.33
95_K	100_P	0.512	0.33
58_L	118_G	0.511	0.33
90_E	97_E	0.511	0.33
28_M	80_Q	0.508	0.32
104_M	117_F	0.507	0.32
42_I	85_Y	0.506	0.32
47_P	50_E	0.505	0.32
15_K	30_E	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2aalA	3	0.9922	100	0.412	Contact Map
4lhpA	3	0.9845	100	0.453	Contact Map
3c6vA	3	0.938	99.9	0.478	Contact Map
4jcuA	3	0.938	99.9	0.511	Contact Map
1mwwA	3	0.9225	99.9	0.518	Contact Map
3e6qA	4	0.8837	99.9	0.529	Contact Map
1u9dA	3	0.8295	99.9	0.533	Contact Map
4lkbF	4	0.9225	99.9	0.544	Contact Map
3fwtA	3	0.8682	99.9	0.555	Contact Map
3fwuA	3	0.8605	99.9	0.556	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.