YLQH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLQH - Uncharacterized protein YlqH

UniProt:	O34867	Sequences: MKEQTPIRKAVALHYDEQKDKAPRVIATGKGHVADNIIKEAKKAGVPIQEDRTLVELMRHLTVDDQIPEALYETVAEIFSFIYKLDESVKNKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	93 (84)
Sequences:	2682 (1822)
Seq/√Len:	198.8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_N	39_K	3.776	1.00
40_E	43_K	3.247	1.00
16_D	19_K	3.014	1.00
20_D	24_R	2.430	1.00
21_K	66_Q	2.209	1.00
40_E	44_A	2.087	1.00
54_L	78_I	2.082	1.00
35_D	38_I	1.811	1.00
11_V	25_V	1.774	1.00
80_S	83_Y	1.764	1.00
9_K	30_K	1.728	1.00
38_I	42_K	1.727	1.00
10_A	35_D	1.722	1.00
32_H	35_D	1.645	1.00
14_H	26_I	1.585	1.00
24_R	66_Q	1.539	1.00
9_K	56_E	1.514	1.00
9_K	55_V	1.497	1.00
39_K	43_K	1.443	1.00
79_F	82_I	1.394	1.00
76_A	80_S	1.371	1.00
49_Q	81_F	1.320	1.00
36_N	40_E	1.313	1.00
25_V	61_L	1.269	1.00
11_V	28_T	1.226	1.00
25_V	58_M	1.214	1.00
69_E	72_Y	1.202	1.00
39_K	42_K	1.200	1.00
31_G	35_D	1.183	1.00
17_E	87_E	1.177	1.00
71_L	79_F	1.173	1.00
38_I	55_V	1.157	1.00
57_L	71_L	1.149	1.00
81_F	85_L	1.147	1.00
73_E	77_E	1.135	1.00
22_A	72_Y	1.133	1.00
76_A	79_F	1.107	1.00
20_D	66_Q	1.104	1.00
14_H	24_R	1.103	1.00
9_K	31_G	1.083	1.00
10_A	38_I	1.081	1.00
12_A	27_A	1.055	1.00
22_A	66_Q	1.045	1.00
11_V	58_M	1.044	1.00
11_V	59_R	1.031	1.00
60_H	70_A	1.028	1.00
35_D	48_I	1.007	1.00
56_E	59_R	0.994	1.00
9_K	52_R	0.987	1.00
5_T	56_E	0.981	1.00
35_D	39_K	0.954	0.99
82_I	85_L	0.951	0.99
6_P	56_E	0.946	0.99
5_T	8_R	0.921	0.99
21_K	24_R	0.917	0.99
7_I	30_K	0.887	0.99
32_H	36_N	0.885	0.99
75_V	79_F	0.883	0.99
15_Y	68_P	0.857	0.99
28_T	62_T	0.849	0.99
28_T	64_D	0.849	0.99
68_P	71_L	0.841	0.98
77_E	81_F	0.835	0.98
8_R	56_E	0.831	0.98
67_I	75_V	0.823	0.98
13_L	79_F	0.813	0.98
14_H	20_D	0.797	0.98
49_Q	78_I	0.795	0.98
48_I	52_R	0.795	0.98
53_T	57_L	0.789	0.98
84_K	88_S	0.773	0.97
51_D	77_E	0.757	0.97
64_D	80_S	0.757	0.97
78_I	82_I	0.754	0.97
42_K	48_I	0.754	0.97
57_L	60_H	0.751	0.97
14_H	19_K	0.745	0.97
71_L	80_S	0.739	0.97
54_L	75_V	0.726	0.96
32_H	39_K	0.713	0.96
8_R	35_D	0.711	0.96
17_E	20_D	0.704	0.96
61_L	65_D	0.694	0.95
15_Y	77_E	0.685	0.95
8_R	31_G	0.677	0.94
8_R	38_I	0.676	0.94
84_K	87_E	0.673	0.94
38_I	50_E	0.661	0.94
7_I	56_E	0.654	0.93
79_F	83_Y	0.650	0.93
42_K	50_E	0.639	0.93
74_T	78_I	0.634	0.92
17_E	83_Y	0.629	0.92
51_D	81_F	0.628	0.92
33_V	36_N	0.627	0.92
71_L	78_I	0.627	0.92
28_T	61_L	0.624	0.92
25_V	28_T	0.621	0.92
18_Q	45_G	0.620	0.91
35_D	42_K	0.617	0.91
30_K	35_D	0.603	0.90
58_M	61_L	0.601	0.90
76_A	81_F	0.594	0.90
12_A	26_I	0.592	0.89
51_D	70_A	0.585	0.89
50_E	54_L	0.584	0.89
53_T	86_D	0.581	0.89
68_P	78_I	0.565	0.87
26_I	46_V	0.563	0.87
54_L	71_L	0.550	0.86
57_L	74_T	0.546	0.85
25_V	72_Y	0.544	0.85
38_I	72_Y	0.540	0.85
36_N	67_I	0.540	0.85
73_E	86_D	0.537	0.84
25_V	71_L	0.535	0.84
80_S	84_K	0.535	0.84
26_I	63_V	0.530	0.84
17_E	60_H	0.527	0.83
15_Y	38_I	0.525	0.83
26_I	37_I	0.521	0.83
58_M	75_V	0.517	0.82
62_T	65_D	0.516	0.82
49_Q	77_E	0.514	0.82
31_G	54_L	0.510	0.81
37_I	74_T	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jljA	2	0.914	100	0.157	Contact Map
3bzsA	1	0.8925	100	0.164	Contact Map
3t7yA	2	0.9032	100	0.178	Contact Map
3b0zB	1	0.8925	100	0.18	Contact Map
3c01E	2	0.9355	100	0.184	Contact Map
3bzyB	3	0.8817	100	0.185	Contact Map
3b1sB	1	0.9032	100	0.186	Contact Map
2vt1B	1	0.8602	100	0.186	Contact Map
2jliA	1	0.8602	100	0.197	Contact Map
3zeyG	1	0.9677	69.6	0.887	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.