MHQD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MHQD - Putative hydrolase MhqD

UniProt:	O34842	Sequences: MKHIYEKGTSDNVLLLLHGTGGNEHDLLSLGRFIDPDAHLLGVRGSVLENGMPRFFKRLSEGVFDEKDLVVRTRELKDFIDEAAETHQFNRGRVIAVGYSNGANIAASLLFHYKDVLKGAILHHPMVPIRGIELPDMAGLPVFIGAGKYDPLCTKEESEELYRYLRDSGASASVYWQDGGHQLTQHEAEQAREWYKEAIV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	200 (189)
Sequences:	3812 (2874)
Seq/√Len:	209.0

ECOLI - YPFH
BACSU - MHQD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
110_L	120_A	3.394	1.00
103_A	125_P	3.364	1.00
177_Q	190_Q	3.110	1.00
155_K	176_W	2.966	1.00
123_H	191_A	2.924	1.00
56_F	126_M	2.892	1.00
24_E	44_R	2.834	1.00
103_A	122_L	2.764	1.00
22_G	26_D	2.545	1.00
121_I	191_A	2.515	1.00
95_I	195_Y	2.509	1.00
14_L	40_L	2.385	1.00
173_S	197_E	2.385	1.00
159_E	176_W	2.368	1.00
95_I	119_G	2.366	1.00
12_N	38_A	2.318	1.00
148_K	178_D	2.273	1.00
162_Y	166_R	2.261	1.00
17_L	76_L	2.126	1.00
145_G	187_E	2.058	1.00
81_D	85_E	2.057	1.00
97_V	121_I	1.970	1.00
175_Y	190_Q	1.931	1.00
106_A	120_A	1.901	1.00
13_V	83_A	1.851	1.00
77_K	109_L	1.808	1.00
12_N	93_R	1.758	1.00
66_E	70_V	1.751	1.00
10_S	13_V	1.749	1.00
151_P	180_G	1.729	1.00
148_K	176_W	1.721	1.00
163_R	166_R	1.707	1.00
158_S	174_V	1.664	1.00
77_K	113_Y	1.636	1.00
41_L	83_A	1.607	1.00
83_A	86_T	1.578	1.00
192_R	196_K	1.560	1.00
44_R	53_P	1.544	1.00
73_T	108_S	1.523	1.00
122_L	144_I	1.513	1.00
110_L	140_L	1.490	1.00
47_V	51_G	1.472	1.00
48_L	71_V	1.445	1.00
155_K	159_E	1.437	1.00
105_I	125_P	1.429	1.00
107_A	144_I	1.411	1.00
122_L	125_P	1.382	1.00
74_R	78_D	1.377	1.00
107_A	122_L	1.369	1.00
124_H	187_E	1.363	1.00
84_A	94_V	1.348	1.00
19_G	100_S	1.339	1.00
144_I	162_Y	1.317	1.00
15_L	80_I	1.296	1.00
142_V	170_A	1.287	1.00
84_A	91_R	1.283	1.00
163_R	167_D	1.276	1.00
185_Q	189_E	1.268	1.00
146_A	158_S	1.256	1.00
11_D	37_D	1.256	1.00
27_L	183_L	1.254	1.00
48_L	54_R	1.247	1.00
143_F	190_Q	1.228	1.00
78_D	82_E	1.227	1.00
23_N	26_D	1.208	1.00
77_K	81_D	1.208	1.00
156_E	160_E	1.196	1.00
82_E	86_T	1.165	1.00
90_N	93_R	1.161	1.00
144_I	172_A	1.143	1.00
104_N	126_M	1.141	1.00
108_S	112_H	1.139	1.00
11_D	93_R	1.137	1.00
119_G	141_P	1.131	1.00
156_E	159_E	1.102	1.00
100_S	181_H	1.082	1.00
124_H	146_A	1.056	1.00
48_L	53_P	1.053	1.00
73_T	109_L	1.046	1.00
162_Y	172_A	1.044	1.00
148_K	155_K	1.034	1.00
162_Y	174_V	1.030	1.00
43_V	76_L	1.026	1.00
143_F	175_Y	1.021	1.00
39_H	83_A	1.019	1.00
81_D	113_Y	1.018	1.00
59_L	63_V	1.018	1.00
65_D	68_D	1.004	1.00
29_S	32_R	1.004	1.00
141_P	171_S	1.000	1.00
145_G	177_Q	0.997	1.00
76_L	105_I	0.992	1.00
82_E	85_E	0.986	1.00
14_L	38_A	0.983	1.00
74_R	77_K	0.982	1.00
13_V	39_H	0.980	1.00
135_P	138_A	0.974	1.00
107_A	161_L	0.969	1.00
143_F	177_Q	0.969	1.00
16_L	97_V	0.961	1.00
43_V	79_F	0.960	1.00
164_Y	168_S	0.945	0.99
184_T	187_E	0.935	0.99
159_E	162_Y	0.933	0.99
16_L	31_G	0.932	0.99
75_E	78_D	0.932	0.99
81_D	84_A	0.930	0.99
159_E	174_V	0.928	0.99
22_G	183_L	0.920	0.99
15_L	96_A	0.916	0.99
33_F	188_A	0.904	0.99
99_Y	124_H	0.902	0.99
25_H	28_L	0.884	0.99
154_T	157_E	0.883	0.99
20_T	58_R	0.883	0.99
16_L	27_L	0.882	0.99
100_S	150_D	0.881	0.99
28_L	42_G	0.880	0.99
160_E	163_R	0.879	0.99
143_F	187_E	0.865	0.99
76_L	109_L	0.860	0.99
46_S	75_E	0.855	0.99
149_Y	179_G	0.855	0.99
69_L	108_S	0.855	0.99
106_A	125_P	0.852	0.99
93_R	118_K	0.850	0.99
164_Y	167_D	0.846	0.99
159_E	163_R	0.845	0.99
31_G	40_L	0.844	0.99
70_V	108_S	0.842	0.99
89_F	94_V	0.840	0.99
96_A	106_A	0.838	0.99
179_G	184_T	0.838	0.99
92_G	116_V	0.837	0.99
155_K	174_V	0.834	0.99
54_R	58_R	0.833	0.99
81_D	115_D	0.831	0.99
177_Q	184_T	0.825	0.99
148_K	179_G	0.825	0.99
193_E	197_E	0.818	0.98
160_E	164_Y	0.811	0.98
80_I	94_V	0.811	0.98
25_H	44_R	0.804	0.98
29_S	33_F	0.796	0.98
165_L	170_A	0.795	0.98
70_V	73_T	0.786	0.98
33_F	185_Q	0.785	0.98
120_A	142_V	0.783	0.98
189_E	192_R	0.783	0.98
45_G	55_F	0.781	0.98
10_S	39_H	0.769	0.98
42_G	97_V	0.766	0.98
57_K	68_D	0.764	0.98
89_F	93_R	0.763	0.98
13_V	41_L	0.763	0.98
28_L	32_R	0.761	0.98
23_N	53_P	0.758	0.97
111_F	170_A	0.756	0.97
35_D	192_R	0.755	0.97
58_R	101_N	0.747	0.97
13_V	89_F	0.747	0.97
80_I	117_L	0.746	0.97
77_K	117_L	0.744	0.97
15_L	83_A	0.737	0.97
123_H	187_E	0.735	0.97
8_G	37_D	0.731	0.97
80_I	83_A	0.730	0.97
177_Q	187_E	0.728	0.97
23_N	44_R	0.724	0.97
20_T	104_N	0.720	0.97
104_N	153_C	0.718	0.97
148_K	159_E	0.716	0.96
104_N	128_P	0.714	0.96
17_L	105_I	0.712	0.96
69_L	105_I	0.710	0.96
73_T	105_I	0.709	0.96
58_R	68_D	0.706	0.96
47_V	53_P	0.704	0.96
72_R	101_N	0.701	0.96
113_Y	117_L	0.700	0.96
190_Q	193_E	0.698	0.96
153_C	157_E	0.693	0.96
30_L	188_A	0.691	0.96
149_Y	180_G	0.688	0.96
97_V	123_H	0.688	0.96
137_M	170_A	0.686	0.95
35_D	38_A	0.685	0.95
22_G	53_P	0.684	0.95
91_R	115_D	0.684	0.95
30_L	35_D	0.683	0.95
107_A	120_A	0.682	0.95
146_A	153_C	0.682	0.95
79_F	83_A	0.681	0.95
13_V	94_V	0.677	0.95
107_A	127_V	0.675	0.95
17_L	106_A	0.668	0.95
189_E	197_E	0.663	0.95
134_L	167_D	0.662	0.95
177_Q	186_H	0.661	0.95
15_L	94_V	0.659	0.94
142_V	165_L	0.655	0.94
28_L	40_L	0.651	0.94
24_E	42_G	0.649	0.94
64_F	108_S	0.648	0.94
144_I	161_L	0.647	0.94
22_G	152_L	0.647	0.94
49_E	52_M	0.645	0.94
80_I	109_L	0.644	0.94
22_G	29_S	0.644	0.94
24_E	43_V	0.642	0.94
85_E	115_D	0.641	0.94
146_A	155_K	0.639	0.93
54_R	101_N	0.638	0.93
67_K	71_V	0.637	0.93
73_T	112_H	0.632	0.93
20_T	54_R	0.630	0.93
147_G	181_H	0.630	0.93
193_E	196_K	0.627	0.93
150_D	181_H	0.627	0.93
49_E	57_K	0.626	0.93
123_H	143_F	0.625	0.93
143_F	194_W	0.618	0.92
77_K	114_K	0.617	0.92
26_D	29_S	0.615	0.92
127_V	144_I	0.615	0.92
133_E	138_A	0.614	0.92
20_T	101_N	0.612	0.92
34_I	192_R	0.610	0.92
81_D	116_V	0.606	0.92
31_G	35_D	0.605	0.91
77_K	115_D	0.604	0.91
96_A	117_L	0.602	0.91
145_G	190_Q	0.597	0.91
96_A	110_L	0.596	0.91
31_G	34_I	0.594	0.91
108_S	128_P	0.594	0.91
123_H	145_G	0.593	0.91
71_V	74_R	0.592	0.91
99_Y	183_L	0.590	0.90
66_E	129_I	0.584	0.90
78_D	81_D	0.584	0.90
149_Y	178_D	0.577	0.89
121_I	143_F	0.577	0.89
110_L	142_V	0.576	0.89
64_F	130_R	0.573	0.89
175_Y	186_H	0.569	0.89
72_R	75_E	0.569	0.89
149_Y	182_Q	0.562	0.88
30_L	33_F	0.561	0.88
91_R	113_Y	0.559	0.88
68_D	72_R	0.559	0.88
48_L	52_M	0.556	0.88
166_R	171_S	0.553	0.87
123_H	183_L	0.552	0.87
72_R	105_I	0.548	0.87
118_K	141_P	0.546	0.87
86_T	171_S	0.541	0.86
111_F	168_S	0.537	0.86
70_V	74_R	0.536	0.86
27_L	31_G	0.536	0.86
97_V	191_A	0.533	0.85
182_Q	185_Q	0.532	0.85
15_L	41_L	0.530	0.85
22_G	27_L	0.529	0.85
130_R	164_Y	0.528	0.85
127_V	161_L	0.526	0.85
101_N	126_M	0.526	0.85
157_E	161_L	0.525	0.85
115_D	137_M	0.524	0.85
175_Y	193_E	0.521	0.84
84_A	90_N	0.520	0.84
171_S	193_E	0.520	0.84
130_R	134_L	0.519	0.84
57_K	65_D	0.518	0.84
95_I	121_I	0.516	0.84
77_K	116_V	0.515	0.83
81_D	139_G	0.513	0.83
26_D	152_L	0.513	0.83
134_L	138_A	0.512	0.83
26_D	183_L	0.512	0.83
25_H	30_L	0.508	0.83
40_L	44_R	0.502	0.82
58_R	72_R	0.502	0.82
12_N	95_I	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3b5eA	2	0.985	100	0.387	Contact Map
3og9A	1	0.99	100	0.41	Contact Map
2r8bA	1	0.985	100	0.411	Contact Map
2h1iA	3	0.995	100	0.42	Contact Map
1fj2A	2	0.995	100	0.444	Contact Map
1auoA	2	0.995	100	0.45	Contact Map
3cn9A	1	0.99	100	0.457	Contact Map
3u0vA	1	0.995	100	0.458	Contact Map
1ycdA	1	0.915	100	0.459	Contact Map
4f21A	1	0.995	99.9	0.494	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.