FAPR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FAPR - Transcription factor FapR

UniProt:	O34835	Sequences: MRRNKRERQELLQQTIQATPFITDEELAGKFGVSIQTIRLDRLELSIPELRERIKNVAEKTLEDEVKSLSLDEVIGEIIDLELDDQAISILEIKQEHVFSRNQIARGHHLFAQANSLAVAVIDDELALTASADIRFTRQVKQGERVVAKAKVTAVEKEKGRTVVEVNSYVGEEIVFSGRFDMYRSKHS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	188 (179)
Sequences:	317 (194)
Seq/√Len:	14.5

BACSU - FAPR

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
146_V	168_S	5.121	1.00
93_I	105_A	3.674	0.99
138_R	144_E	3.574	0.99
111_F	129_T	2.973	0.97
16_I	22_I	2.710	0.96
9_Q	31_F	2.512	0.93
135_R	177_S	2.436	0.92
3_R	11_L	2.425	0.92
80_D	149_K	2.358	0.91
28_A	35_I	2.324	0.90
111_F	115_N	2.323	0.90
84_D	184_R	2.305	0.90
93_I	98_V	2.172	0.87
107_G	128_L	2.107	0.85
130_A	160_G	2.037	0.83
80_D	88_I	2.034	0.83
26_E	59_E	1.989	0.81
88_I	149_K	1.983	0.81
170_V	178_G	1.956	0.80
110_L	146_V	1.932	0.79
105_A	111_F	1.917	0.79
26_E	103_Q	1.904	0.78
82_E	85_D	1.900	0.78
2_R	68_S	1.830	0.75
106_R	129_T	1.755	0.72
133_D	179_R	1.733	0.71
131_S	179_R	1.681	0.69
43_L	149_K	1.660	0.68
5_K	9_Q	1.647	0.67
105_A	146_V	1.641	0.67
84_D	152_V	1.632	0.66
7_E	10_E	1.625	0.66
103_Q	142_Q	1.623	0.66
92_E	145_R	1.596	0.65
138_R	173_E	1.588	0.64
104_I	107_G	1.580	0.64
115_N	129_T	1.570	0.63
75_I	136_F	1.511	0.60
61_T	66_V	1.509	0.60
154_A	179_R	1.506	0.60
10_E	14_Q	1.483	0.59
134_I	151_K	1.468	0.58
52_E	55_K	1.462	0.58
79_I	90_I	1.441	0.57
106_R	115_N	1.440	0.56
133_D	177_S	1.422	0.56
15_T	30_K	1.414	0.55
109_H	121_V	1.406	0.55
113_Q	116_S	1.406	0.55
161_R	181_D	1.376	0.53
66_V	162_T	1.374	0.53
66_V	118_A	1.355	0.52
150_A	176_F	1.352	0.52
68_S	100_S	1.337	0.51
10_E	13_Q	1.335	0.51
93_I	111_F	1.319	0.50
131_S	135_R	1.315	0.50
43_L	86_Q	1.285	0.48
60_K	94_K	1.283	0.48
118_A	184_R	1.268	0.47
144_E	173_E	1.266	0.47
83_L	99_F	1.263	0.47
84_D	97_H	1.223	0.45
97_H	184_R	1.214	0.44
78_I	91_L	1.202	0.43
134_I	180_F	1.185	0.42
78_I	101_R	1.168	0.42
32_G	75_I	1.144	0.40
107_G	115_N	1.142	0.40
108_H	119_V	1.141	0.40
50_L	145_R	1.136	0.40
35_I	64_D	1.122	0.39
91_L	148_A	1.113	0.39
21_F	58_A	1.107	0.38
102_N	181_D	1.103	0.38
50_L	85_D	1.097	0.38
81_L	102_N	1.096	0.38
133_D	165_E	1.079	0.37
54_I	99_F	1.078	0.37
161_R	174_I	1.073	0.37
83_L	101_R	1.072	0.37
106_R	111_F	1.070	0.36
35_I	55_K	1.054	0.36
52_E	81_L	1.037	0.35
36_Q	150_A	1.024	0.34
121_V	142_Q	1.021	0.34
86_Q	151_K	1.012	0.34
104_I	108_H	1.010	0.33
153_T	165_E	1.005	0.33
31_F	54_I	1.003	0.33
93_I	115_N	1.002	0.33
110_L	168_S	0.996	0.33
19_T	62_L	0.956	0.31
91_L	109_H	0.955	0.31
146_V	183_Y	0.950	0.31
151_K	167_N	0.942	0.30
46_S	168_S	0.939	0.30
32_G	147_V	0.929	0.30
9_Q	12_L	0.927	0.29
93_I	110_L	0.924	0.29
43_L	88_I	0.923	0.29
97_H	130_A	0.910	0.29
5_K	44_E	0.908	0.29
18_A	78_I	0.903	0.28
140_V	147_V	0.899	0.28
124_D	127_A	0.894	0.28
91_L	181_D	0.893	0.28
61_T	99_F	0.886	0.28
66_V	77_E	0.882	0.27
122_I	127_A	0.877	0.27
103_Q	110_L	0.874	0.27
167_N	174_I	0.872	0.27
86_Q	149_K	0.871	0.27
67_K	144_E	0.864	0.27
32_G	91_L	0.862	0.27
92_E	171_G	0.862	0.27
36_Q	107_G	0.861	0.27
105_A	115_N	0.857	0.26
161_R	176_F	0.854	0.26
176_F	180_F	0.850	0.26
124_D	184_R	0.848	0.26
150_A	166_V	0.846	0.26
153_T	163_V	0.845	0.26
52_E	57_V	0.840	0.26
44_E	127_A	0.838	0.26
133_D	138_R	0.838	0.26
89_S	117_L	0.834	0.25
5_K	107_G	0.832	0.25
89_S	120_A	0.831	0.25
159_K	163_V	0.827	0.25
83_L	123_D	0.821	0.25
121_V	152_V	0.818	0.25
147_V	154_A	0.816	0.25
89_S	113_Q	0.813	0.25
87_A	182_M	0.810	0.24
12_L	109_H	0.807	0.24
136_F	146_V	0.802	0.24
62_L	65_E	0.789	0.24
5_K	8_R	0.787	0.23
36_Q	111_F	0.787	0.23
74_V	116_S	0.782	0.23
26_E	31_F	0.772	0.23
134_I	174_I	0.771	0.23
20_P	24_D	0.769	0.23
77_E	88_I	0.765	0.23
7_E	54_I	0.762	0.22
105_A	119_V	0.756	0.22
99_F	166_V	0.752	0.22
93_I	129_T	0.752	0.22
66_V	99_F	0.747	0.22
75_I	179_R	0.747	0.22
96_E	104_I	0.746	0.22
110_L	178_G	0.744	0.22
83_L	104_I	0.730	0.21
97_H	162_T	0.728	0.21
114_A	150_A	0.727	0.21
125_E	167_N	0.723	0.21
12_L	25_E	0.722	0.21
84_D	124_D	0.718	0.21
30_K	45_L	0.707	0.20
114_A	180_F	0.706	0.20
86_Q	90_I	0.700	0.20
150_A	180_F	0.700	0.20
29_G	60_K	0.693	0.20
165_E	174_I	0.692	0.20
144_E	168_S	0.687	0.20
118_A	164_V	0.684	0.20
112_A	115_N	0.682	0.20
80_D	180_F	0.680	0.19
134_I	149_K	0.679	0.19
49_E	117_L	0.676	0.19
2_R	52_E	0.676	0.19
25_E	52_E	0.673	0.19
28_A	118_A	0.670	0.19
64_D	162_T	0.668	0.19
69_L	99_F	0.667	0.19
19_T	172_E	0.663	0.19
18_A	155_V	0.662	0.19
151_K	163_V	0.662	0.19
146_V	169_Y	0.661	0.19
43_L	90_I	0.660	0.19
24_D	27_L	0.657	0.19
181_D	184_R	0.657	0.19
122_I	176_F	0.656	0.19
19_T	142_Q	0.651	0.18
95_Q	155_V	0.651	0.18
73_E	126_L	0.650	0.18
75_I	78_I	0.646	0.18
21_F	54_I	0.645	0.18
61_T	81_L	0.638	0.18
50_L	120_A	0.637	0.18
44_E	119_V	0.634	0.18
29_G	174_I	0.631	0.18
78_I	81_L	0.630	0.18
6_R	145_R	0.627	0.18
177_S	181_D	0.624	0.18
102_N	159_K	0.623	0.18
16_I	19_T	0.621	0.18
99_F	182_M	0.617	0.17
85_D	95_Q	0.616	0.17
114_A	164_V	0.615	0.17
74_V	87_A	0.612	0.17
103_Q	141_K	0.612	0.17
73_E	92_E	0.609	0.17
69_L	119_V	0.609	0.17
61_T	65_E	0.608	0.17
12_L	88_I	0.607	0.17
18_A	81_L	0.605	0.17
25_E	91_L	0.604	0.17
83_L	97_H	0.603	0.17
30_K	155_V	0.603	0.17
105_A	129_T	0.598	0.17
71_L	91_L	0.597	0.17
8_R	24_D	0.591	0.17
101_R	175_V	0.590	0.17
126_L	139_Q	0.589	0.17
26_E	46_S	0.589	0.17
69_L	164_V	0.585	0.16
111_F	128_L	0.584	0.16
14_Q	121_V	0.584	0.16
11_L	35_I	0.582	0.16
36_Q	119_V	0.577	0.16
78_I	159_K	0.575	0.16
60_K	141_K	0.573	0.16
174_I	177_S	0.572	0.16
43_L	172_E	0.572	0.16
16_I	70_S	0.572	0.16
83_L	127_A	0.571	0.16
9_Q	36_Q	0.570	0.16
32_G	103_Q	0.568	0.16
7_E	94_K	0.567	0.16
75_I	152_V	0.567	0.16
64_D	121_V	0.566	0.16
18_A	126_L	0.566	0.16
96_E	141_K	0.566	0.16
151_K	165_E	0.563	0.16
107_G	129_T	0.562	0.16
36_Q	129_T	0.560	0.16
61_T	171_G	0.558	0.16
151_K	179_R	0.555	0.16
119_V	182_M	0.554	0.15
59_E	79_I	0.554	0.15
93_I	146_V	0.549	0.15
8_R	12_L	0.544	0.15
107_G	175_V	0.541	0.15
137_T	174_I	0.538	0.15
19_T	32_G	0.538	0.15
16_I	23_T	0.538	0.15
36_Q	105_A	0.537	0.15
45_L	147_V	0.534	0.15
14_Q	18_A	0.530	0.15
60_K	152_V	0.526	0.15
108_H	111_F	0.521	0.15
99_F	173_E	0.520	0.15
18_A	133_D	0.520	0.15
29_G	154_A	0.518	0.14
21_F	88_I	0.517	0.14
54_I	66_V	0.515	0.14
56_N	64_D	0.514	0.14
146_V	181_D	0.513	0.14
134_I	177_S	0.512	0.14
135_R	182_M	0.510	0.14
34_S	37_T	0.509	0.14
34_S	39_R	0.509	0.14
138_R	183_Y	0.505	0.14
90_I	95_Q	0.503	0.14
19_T	91_L	0.500	0.14
23_T	81_L	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4a0zA	2	0.9681	100	0.647	Contact Map
2f3xA	2	0.75	99.9	0.727	Contact Map
2f41A	2	0.5691	99.6	0.802	Contact Map
3bnvA	2	0.7447	99.6	0.809	Contact Map
2gllA	3	0.6862	99.2	0.844	Contact Map
1q4tA	3	0.6755	99.1	0.851	Contact Map
1u1zA	3	0.6649	99.1	0.853	Contact Map
3d6xA	3	0.6596	99	0.857	Contact Map
1ixlA	2	0.6755	99	0.857	Contact Map
1z6bA	3	0.7074	99	0.858	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.