YBCF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YBCF - Putative carbonic anhydrase-like protein YbcF

UniProt:	O34823	Sequences: MNVNQNKKVLFLTDIENGLEPILQEATNTSAENMLTIQSYGASISHPYGEIMRSVIFAIYQEDVEEIFVVGTKDKKTSAGNGLTQLETMKDKIQTLDYLFQNCKPEFLGGTVDEWLNENSSDTIEKSVDMIRHHPLVPSYVKVRGLFVNHKGGKPSIAEVPDVKTGQAMPDHCLS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	175 (151)
Sequences:	4974 (3088)
Seq/√Len:	251.3

ECOLI - CAN CYNT
BACSU - YBCF YVDA YTIB
HALSA - Q9HR64
SULSO - Q97YU3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
124_I	145_G	4.126	1.00
8_K	65_E	3.925	1.00
10_L	55_V	3.026	1.00
128_V	143_V	2.721	1.00
128_V	145_G	2.709	1.00
121_S	156_S	2.675	1.00
66_E	144_R	2.515	1.00
77_T	81_N	2.466	1.00
40_Y	54_S	2.375	1.00
73_K	147_F	2.346	1.00
78_S	81_N	2.297	1.00
120_S	147_F	2.256	1.00
77_T	80_G	2.174	1.00
77_T	82_G	1.963	1.00
74_D	151_K	1.956	1.00
149_N	156_S	1.954	1.00
66_E	142_K	1.880	1.00
146_L	155_P	1.855	1.00
42_A	123_T	1.818	1.00
56_I	60_Y	1.704	1.00
15_I	35_L	1.697	1.00
29_T	34_M	1.667	1.00
69_V	131_I	1.655	1.00
112_V	116_L	1.641	1.00
10_L	64_V	1.609	1.00
122_D	126_K	1.608	1.00
149_N	152_G	1.607	1.00
52_M	134_H	1.547	1.00
121_S	147_F	1.530	1.00
5_Q	17_N	1.484	1.00
37_I	54_S	1.483	1.00
135_P	138_P	1.466	1.00
27_T	34_M	1.457	1.00
122_D	125_E	1.448	1.00
78_S	82_G	1.438	1.00
112_V	115_W	1.389	1.00
73_K	149_N	1.363	1.00
11_F	70_V	1.359	1.00
44_I	51_I	1.350	1.00
82_G	86_L	1.328	1.00
9_V	68_F	1.325	1.00
57_F	61_Q	1.273	1.00
68_F	146_L	1.258	1.00
10_L	67_I	1.252	1.00
146_L	157_I	1.233	1.00
70_V	146_L	1.228	1.00
10_L	54_S	1.226	1.00
88_T	92_K	1.224	1.00
79_A	82_G	1.221	1.00
55_V	131_I	1.198	1.00
41_G	77_T	1.175	1.00
42_A	71_G	1.160	1.00
89_M	92_K	1.157	1.00
130_M	133_H	1.155	1.00
45_S	50_E	1.153	1.00
27_T	70_V	1.152	1.00
132_R	143_V	1.150	1.00
88_T	93_I	1.144	1.00
4_N	74_D	1.134	1.00
124_I	128_V	1.128	1.00
92_K	95_T	1.122	1.00
137_V	141_V	1.110	1.00
13_T	19_L	1.102	1.00
103_C	106_E	1.094	1.00
123_T	127_S	1.088	1.00
111_T	114_E	1.068	1.00
87_E	90_K	1.066	1.00
95_T	98_Y	1.061	1.00
125_E	158_A	1.058	1.00
73_K	150_H	1.049	1.00
104_K	108_L	1.038	1.00
90_K	96_L	1.027	1.00
126_K	129_D	1.019	1.00
39_S	42_A	1.016	1.00
11_F	34_M	1.006	1.00
129_D	132_R	1.002	1.00
136_L	139_S	1.000	1.00
11_F	27_T	0.998	1.00
104_K	107_F	0.995	1.00
59_I	141_V	0.995	1.00
52_M	131_I	0.994	1.00
58_A	64_V	0.986	1.00
59_I	67_I	0.971	1.00
87_E	92_K	0.950	1.00
87_E	91_D	0.949	1.00
59_I	64_V	0.942	1.00
71_G	124_I	0.941	1.00
144_R	157_I	0.940	1.00
5_Q	76_K	0.933	1.00
88_T	91_D	0.931	1.00
59_I	137_V	0.920	1.00
124_I	147_F	0.914	1.00
12_L	55_V	0.910	1.00
21_P	25_E	0.909	1.00
12_L	44_I	0.907	1.00
94_Q	97_D	0.907	1.00
121_S	125_E	0.903	1.00
134_H	138_P	0.903	1.00
97_D	101_Q	0.903	1.00
106_E	118_E	0.895	1.00
129_D	133_H	0.891	1.00
37_I	51_I	0.884	1.00
43_S	127_S	0.881	1.00
63_D	140_Y	0.879	1.00
131_I	143_V	0.878	1.00
35_L	58_A	0.870	1.00
92_K	96_L	0.867	0.99
89_M	93_I	0.866	0.99
44_I	127_S	0.863	0.99
79_A	83_L	0.849	0.99
15_I	62_E	0.831	0.99
93_I	98_Y	0.831	0.99
20_E	36_T	0.831	0.99
135_P	140_Y	0.830	0.99
60_Y	140_Y	0.828	0.99
94_Q	98_Y	0.816	0.99
110_G	113_D	0.815	0.99
15_I	37_I	0.812	0.99
107_F	111_T	0.799	0.99
51_I	55_V	0.799	0.99
27_T	146_L	0.793	0.99
152_G	156_S	0.793	0.99
125_E	145_G	0.792	0.99
126_K	130_M	0.791	0.99
99_L	126_K	0.789	0.99
95_T	102_N	0.778	0.99
59_I	140_Y	0.766	0.99
29_T	33_N	0.766	0.99
71_G	123_T	0.760	0.99
17_N	35_L	0.760	0.99
22_I	25_E	0.759	0.99
9_V	34_M	0.744	0.98
90_K	93_I	0.743	0.98
13_T	70_V	0.736	0.98
57_F	76_K	0.729	0.98
107_F	112_V	0.720	0.98
45_S	51_I	0.719	0.98
92_K	98_Y	0.716	0.98
11_F	21_P	0.715	0.98
12_L	39_S	0.713	0.98
9_V	66_E	0.705	0.98
18_G	32_E	0.705	0.98
105_P	108_L	0.702	0.98
68_F	144_R	0.698	0.98
39_S	50_E	0.696	0.98
6_N	63_D	0.694	0.98
60_Y	136_L	0.687	0.97
25_E	31_A	0.684	0.97
102_N	105_P	0.682	0.97
20_E	26_A	0.681	0.97
50_E	64_V	0.680	0.97
9_V	65_E	0.677	0.97
110_G	116_L	0.674	0.97
95_T	99_L	0.673	0.97
118_E	122_D	0.672	0.97
35_L	57_F	0.671	0.97
134_H	140_Y	0.664	0.97
73_K	151_K	0.663	0.97
13_T	20_E	0.663	0.97
19_L	26_A	0.661	0.97
26_A	155_P	0.654	0.97
39_S	51_I	0.652	0.96
89_M	99_L	0.649	0.96
60_Y	139_S	0.649	0.96
22_I	34_M	0.647	0.96
89_M	98_Y	0.643	0.96
15_I	40_Y	0.642	0.96
91_D	94_Q	0.642	0.96
109_G	112_V	0.642	0.96
50_E	53_R	0.630	0.96
108_L	111_T	0.629	0.96
30_S	33_N	0.628	0.96
147_F	156_S	0.623	0.95
93_I	96_L	0.617	0.95
101_Q	106_E	0.616	0.95
21_P	36_T	0.615	0.95
81_N	85_Q	0.615	0.95
81_N	84_T	0.612	0.95
83_L	86_L	0.612	0.95
93_I	99_L	0.612	0.95
42_A	127_S	0.611	0.95
84_T	87_E	0.610	0.95
78_S	85_Q	0.606	0.95
43_S	123_T	0.606	0.95
4_N	17_N	0.605	0.95
107_F	110_G	0.603	0.95
111_T	115_W	0.602	0.95
91_D	95_T	0.594	0.94
105_P	109_G	0.591	0.94
103_C	110_G	0.591	0.94
105_P	110_G	0.581	0.93
87_E	93_I	0.577	0.93
135_P	139_S	0.572	0.93
14_D	75_K	0.565	0.92
102_N	126_K	0.565	0.92
137_V	140_Y	0.564	0.92
92_K	99_L	0.564	0.92
13_T	21_P	0.563	0.92
10_L	58_A	0.560	0.92
107_F	116_L	0.559	0.92
113_D	117_N	0.558	0.92
15_I	57_F	0.556	0.92
57_F	62_E	0.555	0.92
106_E	109_G	0.551	0.92
110_G	115_W	0.550	0.91
110_G	114_E	0.547	0.91
86_L	89_M	0.547	0.91
128_V	132_R	0.542	0.91
98_Y	101_Q	0.536	0.90
22_I	29_T	0.535	0.90
91_D	97_D	0.533	0.90
103_C	107_F	0.532	0.90
5_Q	35_L	0.526	0.90
20_E	25_E	0.524	0.89
58_A	62_E	0.522	0.89
49_G	134_H	0.520	0.89
82_G	85_Q	0.518	0.89
127_S	130_M	0.517	0.89
10_L	37_I	0.512	0.88
114_E	117_N	0.510	0.88
7_K	35_L	0.509	0.88
132_R	138_P	0.507	0.88
71_G	127_S	0.506	0.88
11_F	127_S	0.501	0.87
113_D	116_L	0.501	0.87
89_M	96_L	0.500	0.87

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ddzA	2	0.9886	100	0.123	Contact Map
3e3iA	6	0.9886	100	0.123	Contact Map
3qy1A	4	0.9886	100	0.128	Contact Map
4rxyA	4	0.9886	100	0.129	Contact Map
3ucjA	4	0.9886	100	0.145	Contact Map
2w3qA	2	0.8971	100	0.155	Contact Map
4o1jA	4	0.92	100	0.156	Contact Map
4o1kA	4	0.9886	100	0.163	Contact Map
1ekjA	5	0.96	100	0.166	Contact Map
3eyxA	2	0.9086	100	0.171	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.