SIRC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SIRC - Precorrin-2 dehydrogenase

UniProt:	O34813	Sequences: MLPLHISLEKKKVVIAGGGSIALRRLKTVISEGADITLVSPDVEPEIKQMAEERRIKWEKRTIEKEDYLNAFFIIAATDNAAVNKEIAQSASPFQLVNCVSDAELGNVYMPKIVKRGHVTVSVSTSGASPKHTKELAENVDKLIDGDFVAEVNRLYQMRRKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	162 (158)
Sequences:	2764 (2054)
Seq/√Len:	163.4

ECOLI - CYSG
BACSU - SIRC
HALSA - Q9HP71

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_R	67_D	5.132	1.00
63_I	90_S	4.593	1.00
14_V	71_A	3.428	1.00
23_L	44_E	3.029	1.00
26_L	47_I	2.881	1.00
43_V	58_W	2.830	1.00
15_I	26_L	2.802	1.00
12_K	37_T	2.496	1.00
11_K	72_F	2.139	1.00
69_L	94_F	2.122	1.00
128_A	156_Y	2.056	1.00
12_K	35_D	2.041	1.00
48_K	60_K	2.032	1.00
125_T	133_T	1.984	1.00
37_T	57_K	1.918	1.00
79_D	84_N	1.905	1.00
78_T	84_N	1.893	1.00
75_I	110_M	1.837	1.00
61_R	64_E	1.831	1.00
5_H	122_S	1.804	1.00
144_I	148_F	1.717	1.00
137_A	141_D	1.692	1.00
102_D	105_L	1.676	1.00
23_L	46_E	1.674	1.00
86_E	90_S	1.629	1.00
43_V	47_I	1.543	1.00
51_A	58_W	1.511	1.00
92_S	107_N	1.496	1.00
119_V	152_V	1.459	1.00
65_K	86_E	1.454	1.00
48_K	52_E	1.441	1.00
66_E	90_S	1.441	1.00
43_V	51_A	1.426	1.00
16_A	87_I	1.415	1.00
39_V	67_D	1.411	1.00
2_L	110_M	1.398	1.00
85_K	89_Q	1.385	1.00
35_D	57_K	1.370	1.00
63_I	87_I	1.350	1.00
114_V	141_D	1.342	1.00
41_P	62_T	1.305	1.00
121_V	140_V	1.303	1.00
139_N	143_L	1.298	1.00
91_A	96_L	1.285	1.00
37_T	71_A	1.283	1.00
76_A	87_I	1.281	1.00
116_R	141_D	1.277	1.00
72_F	95_Q	1.277	1.00
76_A	84_N	1.271	1.00
37_T	59_E	1.268	1.00
119_V	136_L	1.259	1.00
31_S	115_K	1.248	1.00
99_C	105_L	1.245	1.00
16_A	63_I	1.234	1.00
83_V	86_E	1.219	1.00
83_V	87_I	1.218	1.00
18_G	43_V	1.199	1.00
135_E	139_N	1.197	1.00
21_I	24_R	1.186	1.00
80_N	83_V	1.184	1.00
96_L	107_N	1.175	1.00
10_K	35_D	1.165	1.00
25_R	100_V	1.163	1.00
15_I	36_I	1.163	1.00
121_V	144_I	1.161	1.00
101_S	106_G	1.160	1.00
88_A	92_S	1.148	1.00
74_I	91_A	1.141	1.00
85_K	105_L	1.136	1.00
65_K	90_S	1.130	1.00
64_E	67_D	1.128	1.00
4_L	73_F	1.116	1.00
12_K	71_A	1.113	1.00
88_A	106_G	1.101	1.00
112_K	137_A	1.091	1.00
43_V	60_K	1.091	1.00
51_A	56_I	1.064	0.99
27_K	46_E	1.063	0.99
49_Q	53_E	1.061	0.99
118_H	128_A	1.056	0.99
15_I	29_V	1.048	0.99
4_L	108_V	1.029	0.99
134_K	138_E	1.021	0.99
88_A	99_C	1.019	0.99
81_A	102_D	1.015	0.99
50_M	55_R	1.001	0.99
15_I	22_A	0.985	0.99
2_L	28_T	0.972	0.99
14_V	39_V	0.972	0.99
11_K	107_N	0.952	0.99
46_E	50_M	0.948	0.99
106_G	109_Y	0.946	0.99
114_V	123_V	0.931	0.99
30_I	55_R	0.926	0.98
18_G	40_S	0.921	0.98
8_L	13_V	0.913	0.98
47_I	51_A	0.913	0.98
75_I	108_V	0.910	0.98
102_D	106_G	0.906	0.98
120_T	126_S	0.889	0.98
74_I	96_L	0.888	0.98
125_T	152_V	0.879	0.98
13_V	29_V	0.876	0.98
68_Y	74_I	0.875	0.98
103_A	106_G	0.870	0.98
138_E	141_D	0.869	0.98
123_V	136_L	0.869	0.98
25_R	124_S	0.862	0.98
22_A	40_S	0.849	0.97
118_H	153_N	0.846	0.97
13_V	34_A	0.835	0.97
9_E	33_G	0.831	0.97
90_S	94_F	0.822	0.97
135_E	138_E	0.820	0.97
49_Q	52_E	0.815	0.97
98_N	106_G	0.814	0.97
89_Q	93_P	0.811	0.96
88_A	107_N	0.806	0.96
41_P	58_W	0.802	0.96
123_V	140_V	0.800	0.96
45_P	48_K	0.795	0.96
28_T	115_K	0.789	0.96
63_I	68_Y	0.785	0.96
7_S	109_Y	0.784	0.96
44_E	47_I	0.784	0.96
101_S	112_K	0.783	0.96
111_P	122_S	0.779	0.96
30_I	56_I	0.776	0.95
117_G	120_T	0.774	0.95
91_A	97_V	0.773	0.95
149_V	152_V	0.770	0.95
23_L	50_M	0.770	0.95
2_L	32_E	0.767	0.95
77_A	100_V	0.765	0.95
39_V	71_A	0.764	0.95
41_P	83_V	0.758	0.95
36_I	56_I	0.757	0.95
68_Y	96_L	0.757	0.95
81_A	104_E	0.749	0.94
32_E	36_I	0.742	0.94
65_K	93_P	0.741	0.94
28_T	113_I	0.741	0.94
132_H	152_V	0.736	0.94
25_R	131_K	0.732	0.94
98_N	108_V	0.730	0.94
125_T	130_P	0.716	0.93
47_I	50_M	0.710	0.93
23_L	27_K	0.701	0.92
6_I	108_V	0.686	0.91
119_V	125_T	0.685	0.91
26_L	30_I	0.677	0.91
65_K	94_F	0.676	0.91
118_H	156_Y	0.673	0.91
18_G	22_A	0.670	0.90
40_S	43_V	0.664	0.90
116_R	149_V	0.663	0.90
131_K	134_K	0.656	0.90
99_C	106_G	0.654	0.89
26_L	56_I	0.652	0.89
147_D	150_A	0.649	0.89
48_K	58_W	0.647	0.89
51_A	54_R	0.644	0.89
88_A	105_L	0.644	0.89
100_V	110_M	0.642	0.89
76_A	99_C	0.639	0.88
13_V	36_I	0.639	0.88
38_L	56_I	0.638	0.88
117_G	149_V	0.634	0.88
5_H	120_T	0.629	0.88
83_V	152_V	0.625	0.87
75_I	107_N	0.621	0.87
119_V	144_I	0.614	0.86
23_L	47_I	0.613	0.86
13_V	73_F	0.612	0.86
21_I	84_N	0.609	0.86
22_A	110_M	0.607	0.86
136_L	140_V	0.603	0.85
88_A	97_V	0.601	0.85
150_A	153_N	0.599	0.85
153_N	157_Q	0.597	0.85
21_I	99_C	0.592	0.84
84_N	102_D	0.589	0.84
136_L	144_I	0.588	0.84
41_P	61_R	0.587	0.84
59_E	67_D	0.587	0.84
43_V	48_K	0.587	0.84
75_I	100_V	0.584	0.83
144_I	151_E	0.583	0.83
25_R	137_A	0.582	0.83
21_I	79_D	0.581	0.83
21_I	100_V	0.580	0.83
54_R	57_K	0.580	0.83
78_T	83_V	0.579	0.83
139_N	144_I	0.578	0.83
63_I	66_E	0.572	0.82
45_P	49_Q	0.571	0.82
85_K	104_E	0.571	0.82
67_D	70_N	0.566	0.81
26_L	36_I	0.562	0.81
6_I	107_N	0.562	0.81
151_E	154_R	0.562	0.81
154_R	157_Q	0.561	0.81
19_G	78_T	0.559	0.81
2_L	5_H	0.558	0.81
21_I	78_T	0.557	0.80
68_Y	94_F	0.555	0.80
123_V	137_A	0.552	0.80
21_I	77_A	0.547	0.79
130_P	159_R	0.545	0.79
29_V	36_I	0.543	0.79
27_K	49_Q	0.541	0.78
118_H	152_V	0.541	0.78
112_K	138_E	0.540	0.78
118_H	149_V	0.539	0.78
50_M	54_R	0.538	0.78
27_K	31_S	0.537	0.78
74_I	87_I	0.536	0.78
66_E	69_L	0.530	0.77
39_V	66_E	0.529	0.77
4_L	110_M	0.529	0.77
128_A	153_N	0.528	0.77
113_I	120_T	0.528	0.77
101_S	137_A	0.527	0.77
8_L	11_K	0.519	0.76
28_T	75_I	0.519	0.76
32_E	120_T	0.518	0.75
41_P	60_K	0.515	0.75
119_V	132_H	0.514	0.75
148_F	151_E	0.511	0.74
111_P	126_S	0.510	0.74
16_A	83_V	0.510	0.74
25_R	130_P	0.509	0.74
31_S	113_I	0.508	0.74
154_R	158_M	0.506	0.74
129_S	134_K	0.504	0.73
122_S	130_P	0.503	0.73
124_S	130_P	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1pjqA	2	1	100	0.19	Contact Map
1kyqA	2	1	100	0.211	Contact Map
3dfzA	2	0.9938	100	0.259	Contact Map
4d79A	2	0.9383	98.6	0.791	Contact Map
2g1uA	2	0.784	98.3	0.812	Contact Map
3c85A	2	0.858	97.9	0.828	Contact Map
3d4oA	4	0.858	97.8	0.83	Contact Map
2rirA	4	0.9012	97.8	0.83	Contact Map
1id1A	2	0.8642	97.8	0.832	Contact Map
1lssA	3	0.7593	97.8	0.833	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.