YTWI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTWI - UPF0756 membrane protein YtwI

UniProt:	O34811	Sequences: MFTQANLFLILLLAIALIAKNQSLLFAVSVLLIIKIVGLDQKLFPTIQSKGINWGVTIITIAVLVPIATGEIGFKQLGEAMRSSYAWIALGAGIAVALIAKNGLTLLENDPHITTALVIGTILAVALFGGVAVGPLIGAGIAYLAMQIVKLFTS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (141)
Sequences:	407 (226)
Seq/√Len:	19.0

ECOLI - YEAL
BACSU - YTWI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
133_V	136_L	3.219	0.99
39_L	45_P	2.946	0.99
9_L	68_A	2.931	0.99
121_T	125_V	2.877	0.99
124_A	138_G	2.812	0.99
10_I	14_A	2.691	0.98
102_N	144_L	2.549	0.97
21_N	125_V	2.481	0.97
67_I	123_L	2.467	0.97
21_N	97_A	2.381	0.96
94_I	123_L	2.337	0.95
7_L	11_L	2.311	0.95
99_I	108_E	2.206	0.94
88_I	145_A	2.187	0.93
14_A	18_I	2.172	0.93
102_N	143_Y	2.048	0.91
97_A	121_T	1.987	0.89
82_R	146_M	1.840	0.85
96_V	137_I	1.815	0.84
100_A	137_I	1.695	0.80
90_L	124_A	1.656	0.78
97_A	125_V	1.640	0.78
13_L	29_S	1.609	0.76
6_N	32_L	1.552	0.74
46_T	54_W	1.518	0.72
132_A	143_Y	1.514	0.72
21_N	121_T	1.475	0.70
33_I	37_V	1.471	0.69
125_V	137_I	1.464	0.69
87_W	91_G	1.458	0.69
39_L	43_L	1.451	0.68
96_V	125_V	1.413	0.66
13_L	105_T	1.408	0.66
83_S	94_I	1.344	0.62
84_S	129_G	1.343	0.62
13_L	113_I	1.331	0.61
96_V	121_T	1.317	0.61
53_N	143_Y	1.307	0.60
56_V	96_V	1.305	0.60
98_L	101_K	1.290	0.59
31_L	69_T	1.283	0.59
93_G	138_G	1.271	0.58
101_K	113_I	1.264	0.57
44_F	65_V	1.263	0.57
10_I	17_L	1.261	0.57
27_A	73_G	1.260	0.57
118_V	122_I	1.260	0.57
63_V	139_A	1.259	0.57
21_N	56_V	1.258	0.57
59_I	114_T	1.247	0.56
21_N	137_I	1.246	0.56
6_N	129_G	1.232	0.55
24_L	60_T	1.223	0.55
63_V	136_L	1.179	0.52
12_L	139_A	1.171	0.52
28_V	64_L	1.163	0.51
29_S	33_I	1.132	0.49
35_K	68_A	1.131	0.49
23_S	67_I	1.119	0.48
121_T	137_I	1.106	0.47
20_K	118_V	1.092	0.47
44_F	81_M	1.084	0.46
100_A	131_V	1.080	0.46
39_L	136_L	1.074	0.45
40_D	104_L	1.069	0.45
16_A	24_L	1.067	0.45
47_I	61_I	1.060	0.45
29_S	61_I	1.053	0.44
90_L	131_V	1.047	0.44
81_M	90_L	1.038	0.43
21_N	96_V	1.034	0.43
19_A	24_L	1.013	0.42
126_A	131_V	1.007	0.41
31_L	63_V	0.994	0.40
102_N	138_G	0.990	0.40
91_G	95_A	0.987	0.40
13_L	28_V	0.978	0.39
47_I	119_I	0.966	0.39
10_I	32_L	0.954	0.38
34_I	146_M	0.944	0.37
123_L	127_L	0.943	0.37
93_G	111_P	0.943	0.37
20_K	33_I	0.937	0.37
65_V	69_T	0.927	0.36
101_K	108_E	0.918	0.36
67_I	127_L	0.918	0.36
36_I	68_A	0.913	0.36
60_T	140_G	0.908	0.35
9_L	101_K	0.897	0.35
77_L	145_A	0.896	0.35
87_W	132_A	0.879	0.34
36_I	40_D	0.875	0.33
19_A	122_I	0.872	0.33
30_V	47_I	0.862	0.33
25_L	33_I	0.858	0.33
27_A	36_I	0.857	0.32
100_A	126_A	0.856	0.32
29_S	47_I	0.853	0.32
43_L	119_I	0.850	0.32
29_S	113_I	0.840	0.32
13_L	49_S	0.840	0.32
26_F	119_I	0.834	0.31
34_I	44_F	0.832	0.31
81_M	131_V	0.831	0.31
118_V	132_A	0.828	0.31
44_F	119_I	0.828	0.31
99_I	124_A	0.825	0.31
31_L	100_A	0.823	0.31
56_V	100_A	0.822	0.31
64_L	118_V	0.803	0.30
12_L	141_I	0.792	0.29
26_F	30_V	0.792	0.29
23_S	137_I	0.790	0.29
13_L	32_L	0.790	0.29
15_I	18_I	0.788	0.29
97_A	104_L	0.785	0.29
57_T	129_G	0.785	0.29
51_G	89_A	0.779	0.28
96_V	100_A	0.775	0.28
88_I	142_A	0.774	0.28
35_K	51_G	0.774	0.28
18_I	46_T	0.765	0.28
119_I	127_L	0.762	0.27
22_Q	81_M	0.752	0.27
106_L	109_N	0.751	0.27
67_I	115_T	0.749	0.27
18_I	91_G	0.748	0.27
100_A	125_V	0.746	0.27
16_A	52_I	0.745	0.27
6_N	38_G	0.739	0.26
43_L	83_S	0.738	0.26
21_N	100_A	0.733	0.26
14_A	33_I	0.727	0.26
18_I	117_L	0.726	0.26
27_A	107_L	0.722	0.25
100_A	121_T	0.709	0.25
94_I	104_L	0.708	0.25
142_A	146_M	0.705	0.25
17_L	25_L	0.703	0.25
93_G	124_A	0.697	0.24
19_A	109_N	0.697	0.24
34_I	57_T	0.682	0.24
24_L	84_S	0.679	0.23
85_Y	91_G	0.677	0.23
44_F	89_A	0.676	0.23
51_G	117_L	0.675	0.23
47_I	71_E	0.671	0.23
7_L	65_V	0.670	0.23
97_A	100_A	0.668	0.23
43_L	47_I	0.667	0.23
11_L	70_G	0.663	0.23
63_V	99_I	0.658	0.23
11_L	46_T	0.657	0.22
19_A	110_D	0.656	0.22
27_A	72_I	0.650	0.22
58_I	107_L	0.645	0.22
30_V	61_I	0.639	0.22
48_Q	53_N	0.629	0.21
82_R	113_I	0.627	0.21
47_I	65_V	0.620	0.21
83_S	86_A	0.616	0.21
18_I	37_V	0.615	0.21
124_A	142_A	0.607	0.20
19_A	46_T	0.596	0.20
60_T	117_L	0.593	0.20
102_N	131_V	0.592	0.20
25_L	59_I	0.589	0.20
60_T	139_A	0.587	0.20
107_L	112_H	0.585	0.19
81_M	144_L	0.585	0.19
18_I	129_G	0.585	0.19
31_L	133_V	0.583	0.19
56_V	137_I	0.582	0.19
50_K	76_Q	0.580	0.19
16_A	106_L	0.580	0.19
116_A	132_A	0.574	0.19
52_I	56_V	0.566	0.19
73_G	87_W	0.566	0.19
23_S	96_V	0.561	0.19
33_I	81_M	0.559	0.18
54_W	63_V	0.551	0.18
8_F	50_K	0.549	0.18
45_P	123_L	0.549	0.18
8_F	87_W	0.548	0.18
50_K	53_N	0.547	0.18
53_N	125_V	0.544	0.18
20_K	104_L	0.544	0.18
97_A	133_V	0.543	0.18
123_L	128_F	0.540	0.18
46_T	83_S	0.538	0.18
44_F	61_I	0.537	0.18
22_Q	41_Q	0.536	0.18
36_I	57_T	0.529	0.17
99_I	105_T	0.527	0.17
33_I	119_I	0.525	0.17
73_G	76_Q	0.524	0.17
9_L	35_K	0.523	0.17
56_V	97_A	0.523	0.17
23_S	64_L	0.521	0.17
119_I	126_A	0.516	0.17
28_V	49_S	0.515	0.17
131_V	137_I	0.514	0.17
19_A	146_M	0.512	0.17
29_S	49_S	0.511	0.17
33_I	82_R	0.508	0.17
34_I	47_I	0.508	0.17
12_L	113_I	0.507	0.17
93_G	125_V	0.506	0.17
27_A	38_G	0.503	0.16
8_F	64_L	0.502	0.16
44_F	146_M	0.500	0.16
59_I	118_V	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4o9uB	2	0.6883	22.9	0.942	Contact Map
4o93B	1	0.8052	21.4	0.943	Contact Map
2qi9A	2	0.7597	4.5	0.958	Contact Map
2nq2A	2	0.6558	3.9	0.959	Contact Map
4bemA	3	0.487	3.4	0.961	Contact Map
1wu0A	1	0.4675	3	0.962	Contact Map
1a91A	1	0.474	3	0.962	Contact Map
1i5pA	1	0.526	2.5	0.963	Contact Map
4u9nA	2	0.8961	2.4	0.963	Contact Map
2jlnA	1	0.8636	2.4	0.963	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.