YTFJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTFJ - Uncharacterized spore protein YtfJ

UniProt:	O34806	Sequences: MADHPIQGLMKTAMENLKEMIDVNTIIGDPVETPDGSVILTVSKVGFGFAAGGSEFGGKPAEKKSEDDETREQKLPFGGGSGGGVSITPIAFLIVGSTGIRMLHLDENTHLIEKILDAAPQTLERIQQMFKKNNKNQSQGQNQNQMNNMNY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (132)
Sequences:	429 (295)
Seq/√Len:	25.6

BACSU - YTFJ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_A	51_A	4.387	1.00
54_S	78_G	3.301	1.00
9_L	81_S	2.824	1.00
41_T	122_T	2.593	0.99
56_F	78_G	2.514	0.99
50_A	82_G	2.360	0.98
17_L	41_T	2.305	0.98
26_I	47_F	2.267	0.98
47_F	91_A	2.203	0.97
126_I	131_K	2.189	0.97
112_I	121_Q	2.070	0.96
17_L	20_M	2.023	0.96
27_I	94_I	2.001	0.95
10_M	13_A	1.964	0.95
91_A	105_L	1.956	0.95
69_E	72_E	1.769	0.91
5_P	10_M	1.693	0.89
44_K	101_R	1.687	0.89
6_I	26_I	1.623	0.87
41_T	104_H	1.576	0.85
87_I	114_K	1.562	0.85
6_I	9_L	1.515	0.83
83_G	105_L	1.505	0.82
78_G	93_L	1.499	0.82
44_K	91_A	1.486	0.82
7_Q	26_I	1.464	0.81
50_A	56_F	1.445	0.80
14_M	81_S	1.443	0.80
104_H	122_T	1.413	0.78
40_L	105_L	1.411	0.78
44_K	87_I	1.411	0.78
41_T	103_L	1.398	0.77
115_I	130_F	1.386	0.77
14_M	31_V	1.373	0.76
136_N	139_Q	1.359	0.75
42_V	95_V	1.358	0.75
55_E	121_Q	1.328	0.74
104_H	114_K	1.319	0.73
50_A	76_P	1.314	0.73
31_V	36_G	1.310	0.73
87_I	125_R	1.297	0.72
119_A	124_E	1.293	0.72
56_F	76_P	1.269	0.70
21_I	107_E	1.269	0.70
9_L	78_G	1.256	0.69
60_P	100_I	1.246	0.69
21_I	98_T	1.245	0.69
33_T	114_K	1.240	0.68
42_V	94_I	1.199	0.66
44_K	60_P	1.196	0.65
30_P	56_F	1.194	0.65
6_I	95_V	1.189	0.65
88_T	98_T	1.186	0.65
39_I	50_A	1.181	0.64
14_M	20_M	1.160	0.63
6_I	12_T	1.160	0.63
3_D	7_Q	1.155	0.63
32_E	55_E	1.154	0.63
42_V	105_L	1.145	0.62
13_A	125_R	1.135	0.61
10_M	14_M	1.134	0.61
12_T	16_N	1.128	0.61
40_L	132_K	1.125	0.61
38_V	96_G	1.116	0.60
73_Q	123_L	1.085	0.58
26_I	43_S	1.063	0.56
114_K	117_D	1.054	0.56
83_G	90_I	1.048	0.55
111_L	116_L	1.047	0.55
134_N	139_Q	1.002	0.52
60_P	71_R	0.987	0.51
115_I	133_N	0.986	0.51
122_T	130_F	0.981	0.50
31_V	40_L	0.962	0.49
16_N	83_G	0.961	0.49
42_V	104_H	0.960	0.49
4_H	10_M	0.942	0.47
21_I	115_I	0.941	0.47
115_I	129_M	0.921	0.46
39_I	82_G	0.921	0.46
38_V	136_N	0.909	0.45
61_A	134_N	0.907	0.45
101_R	112_I	0.906	0.45
55_E	101_R	0.904	0.45
13_A	90_I	0.903	0.44
12_T	38_V	0.902	0.44
69_E	118_A	0.900	0.44
111_L	119_A	0.882	0.43
104_H	110_H	0.870	0.42
14_M	25_T	0.866	0.42
135_K	139_Q	0.865	0.42
11_K	15_E	0.859	0.41
55_E	76_P	0.850	0.41
123_L	139_Q	0.847	0.40
16_N	47_F	0.846	0.40
21_I	122_T	0.832	0.39
72_E	135_K	0.824	0.39
91_A	102_M	0.811	0.38
105_L	110_H	0.804	0.37
50_A	54_S	0.794	0.37
9_L	86_S	0.789	0.36
15_E	18_K	0.783	0.36
46_G	87_I	0.783	0.36
17_L	104_H	0.783	0.36
20_M	31_V	0.783	0.36
135_K	138_S	0.779	0.36
39_I	90_I	0.775	0.35
20_M	45_V	0.770	0.35
136_N	140_G	0.765	0.35
133_N	138_S	0.765	0.35
26_I	55_E	0.760	0.34
126_I	129_M	0.759	0.34
30_P	38_V	0.749	0.34
2_A	7_Q	0.749	0.34
96_G	99_G	0.746	0.34
34_P	117_D	0.738	0.33
13_A	111_L	0.737	0.33
61_A	124_E	0.735	0.33
24_N	35_D	0.732	0.33
91_A	110_H	0.730	0.33
23_V	76_P	0.729	0.32
101_R	125_R	0.729	0.32
96_G	101_R	0.723	0.32
73_Q	135_K	0.723	0.32
36_G	80_G	0.717	0.32
12_T	18_K	0.707	0.31
101_R	113_E	0.705	0.31
42_V	102_M	0.703	0.31
116_L	126_I	0.697	0.30
15_E	115_I	0.693	0.30
119_A	127_Q	0.685	0.30
57_G	75_L	0.682	0.30
30_P	94_I	0.679	0.29
34_P	127_Q	0.678	0.29
93_L	111_L	0.677	0.29
133_N	136_N	0.677	0.29
40_L	87_I	0.676	0.29
98_T	118_A	0.673	0.29
61_A	71_R	0.670	0.29
41_T	94_I	0.668	0.29
72_E	94_I	0.668	0.29
3_D	59_K	0.665	0.28
69_E	73_Q	0.662	0.28
24_N	29_D	0.659	0.28
42_V	93_L	0.657	0.28
74_K	101_R	0.657	0.28
2_A	18_K	0.655	0.28
58_G	99_G	0.650	0.28
9_L	77_F	0.636	0.27
104_H	123_L	0.631	0.26
21_I	41_T	0.630	0.26
11_K	31_V	0.630	0.26
75_L	95_V	0.624	0.26
50_A	74_K	0.617	0.26
33_T	36_G	0.616	0.26
26_I	91_A	0.616	0.26
31_V	96_G	0.612	0.25
59_K	135_K	0.608	0.25
126_I	135_K	0.604	0.25
61_A	113_E	0.603	0.25
19_E	85_V	0.598	0.25
74_K	140_G	0.594	0.24
16_N	109_T	0.594	0.24
98_T	109_T	0.592	0.24
110_H	113_E	0.590	0.24
5_P	23_V	0.589	0.24
103_L	113_E	0.582	0.24
126_I	138_S	0.577	0.24
73_Q	116_L	0.576	0.23
17_L	85_V	0.565	0.23
44_K	109_T	0.564	0.23
13_A	119_A	0.561	0.23
55_E	59_K	0.559	0.23
33_T	104_H	0.558	0.23
30_P	47_F	0.551	0.22
8_G	75_L	0.551	0.22
59_K	128_Q	0.551	0.22
83_G	87_I	0.549	0.22
11_K	90_I	0.549	0.22
42_V	121_Q	0.548	0.22
7_Q	102_M	0.544	0.22
32_E	87_I	0.540	0.22
70_T	138_S	0.537	0.21
112_I	129_M	0.536	0.21
70_T	134_N	0.532	0.21
2_A	127_Q	0.532	0.21
43_S	49_F	0.529	0.21
111_L	126_I	0.527	0.21
73_Q	131_K	0.525	0.21
44_K	72_E	0.521	0.21
46_G	111_L	0.514	0.20
74_K	123_L	0.513	0.20
70_T	122_T	0.513	0.20
73_Q	134_N	0.509	0.20
128_Q	138_S	0.507	0.20
13_A	18_K	0.506	0.20
2_A	72_E	0.503	0.20
109_T	117_D	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2pihA	2	0.2781	14.7	0.952	Contact Map
2jmkA	1	0.6424	6	0.959	Contact Map
1t72A	5	0.3841	4.7	0.961	Contact Map
2oeqA	4	0.2715	4.2	0.962	Contact Map
3c3dA	2	0.5033	4.1	0.963	Contact Map
2jvdA	1	0.2318	3.4	0.964	Contact Map
3bhpA	3	0.2318	3.3	0.964	Contact Map
2hepA	1	0.2318	3.1	0.965	Contact Map
4r3oM	1	0.3377	2.7	0.966	Contact Map
2jzvA	1	0.2583	2.6	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.