COAD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COAD - Phosphopantetheine adenylyltransferase

UniProt:	O34797	Sequences: MASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKKPLFSVEERCELLREVTKDIPNITVETSQGLLIDYAKRKNAKAILRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMTNNQYSFLSSSIVKEVARYNGSVSEFVPPEVELALQQKFRQG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (156)
Sequences:	3532 (2125)
Seq/√Len:	170.2

ECOLI - COAD
BACSU - COAD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_Q	66_T	4.757	1.00
68_E	77_Y	3.593	1.00
14_V	55_L	3.379	1.00
4_I	31_Q	3.208	1.00
68_E	81_K	2.997	1.00
25_G	87_L	2.956	1.00
23_K	61_D	2.687	1.00
26_A	64_N	2.531	1.00
6_V	78_A	2.187	1.00
58_V	149_E	2.181	1.00
14_V	22_I	2.158	1.00
50_E	157_K	2.137	1.00
47_S	50_E	2.093	1.00
10_S	44_P	1.991	1.00
54_L	153_A	1.888	1.00
108_V	144_E	1.874	1.00
52_C	56_R	1.803	1.00
53_E	56_R	1.779	1.00
79_K	110_D	1.775	1.00
135_V	140_G	1.774	1.00
88_R	102_G	1.761	1.00
151_E	155_Q	1.738	1.00
29_F	32_V	1.629	1.00
72_G	80_R	1.613	1.00
59_T	62_I	1.591	1.00
33_Y	81_K	1.574	1.00
19_L	59_T	1.569	1.00
79_K	112_S	1.559	1.00
24_R	114_E	1.544	1.00
19_L	147_P	1.542	1.00
52_C	69_T	1.516	1.00
57_E	149_E	1.485	1.00
86_I	113_I	1.479	1.00
152_L	156_Q	1.478	1.00
78_A	113_I	1.475	1.00
57_E	153_A	1.465	1.00
53_E	57_E	1.459	1.00
75_I	110_D	1.452	1.00
77_Y	81_K	1.439	1.00
105_V	135_V	1.420	1.00
74_L	86_I	1.400	1.00
5_A	32_V	1.396	1.00
105_V	131_I	1.377	1.00
20_D	121_N	1.359	1.00
22_I	34_V	1.348	1.00
4_I	33_Y	1.343	1.00
37_L	70_S	1.342	1.00
57_E	60_K	1.340	1.00
46_F	54_L	1.332	1.00
35_C	70_S	1.314	1.00
48_V	69_T	1.281	1.00
134_E	138_Y	1.280	1.00
153_A	156_Q	1.259	1.00
41_S	134_E	1.240	1.00
72_G	76_D	1.226	1.00
76_D	79_K	1.213	1.00
28_I	116_F	1.206	1.00
26_A	62_I	1.181	1.00
143_S	151_E	1.169	1.00
90_L	96_F	1.147	1.00
36_V	52_C	1.133	1.00
6_V	77_Y	1.124	1.00
75_I	113_I	1.123	1.00
90_L	117_F	1.089	1.00
148_P	152_L	1.078	1.00
35_C	77_Y	1.069	1.00
28_I	118_M	1.066	1.00
23_K	62_I	1.062	1.00
142_V	154_L	1.057	0.99
62_I	65_I	1.055	0.99
146_V	150_V	1.042	0.99
29_F	85_A	1.034	0.99
3_S	84_K	1.025	0.99
8_P	74_L	1.012	0.99
58_V	147_P	1.009	0.99
4_I	82_N	1.008	0.99
3_S	30_E	1.004	0.99
4_I	83_A	1.004	0.99
92_A	101_Q	0.999	0.99
92_A	100_M	0.996	0.99
150_V	154_L	0.990	0.99
8_P	86_I	0.989	0.99
78_A	83_A	0.981	0.99
124_Y	127_L	0.979	0.99
21_I	118_M	0.978	0.99
16_Y	147_P	0.978	0.99
40_S	138_Y	0.970	0.99
29_F	87_L	0.964	0.99
93_V	97_E	0.957	0.99
5_A	29_F	0.951	0.99
104_S	125_S	0.945	0.99
52_C	67_V	0.941	0.99
137_R	158_F	0.939	0.99
10_S	37_L	0.932	0.99
103_T	117_F	0.925	0.99
5_A	87_L	0.918	0.99
66_T	81_K	0.910	0.98
22_I	32_V	0.904	0.98
33_Y	83_A	0.901	0.98
142_V	146_V	0.895	0.98
38_N	71_Q	0.893	0.98
45_L	158_F	0.890	0.98
5_A	85_A	0.874	0.98
100_M	119_M	0.868	0.98
94_S	101_Q	0.866	0.98
54_L	150_V	0.862	0.98
38_N	48_V	0.848	0.98
37_L	138_Y	0.847	0.98
110_D	113_I	0.847	0.98
36_V	69_T	0.842	0.97
3_S	85_A	0.833	0.97
100_M	104_S	0.830	0.97
7_C	88_R	0.812	0.97
120_T	125_S	0.808	0.97
141_S	144_E	0.804	0.97
55_L	67_V	0.804	0.97
57_E	152_L	0.797	0.96
6_V	83_A	0.793	0.96
33_Y	66_T	0.791	0.96
148_P	151_E	0.786	0.96
45_L	157_K	0.780	0.96
53_E	153_A	0.770	0.96
14_V	150_V	0.769	0.96
19_L	58_V	0.768	0.96
49_E	53_E	0.767	0.96
15_T	132_V	0.766	0.96
36_V	55_L	0.766	0.96
6_V	35_C	0.761	0.95
27_H	84_K	0.756	0.95
108_V	145_F	0.755	0.95
22_I	59_T	0.749	0.95
150_V	153_A	0.742	0.95
59_T	64_N	0.733	0.94
149_E	152_L	0.728	0.94
46_F	50_E	0.727	0.94
59_T	65_I	0.727	0.94
92_A	97_E	0.726	0.94
106_N	115_T	0.726	0.94
152_L	155_Q	0.724	0.94
25_G	32_V	0.719	0.94
44_P	48_V	0.719	0.94
76_D	80_R	0.714	0.94
28_I	85_A	0.711	0.93
22_I	65_I	0.710	0.93
109_L	135_V	0.709	0.93
32_V	87_L	0.706	0.93
34_V	55_L	0.704	0.93
104_S	122_N	0.703	0.93
55_L	59_T	0.702	0.93
56_R	66_T	0.701	0.93
7_C	120_T	0.701	0.93
100_M	125_S	0.696	0.93
122_N	125_S	0.695	0.93
72_G	77_Y	0.694	0.93
7_C	22_I	0.681	0.92
96_F	100_M	0.680	0.92
20_D	24_R	0.676	0.92
16_Y	19_L	0.670	0.91
14_V	19_L	0.669	0.91
48_V	52_C	0.664	0.91
8_P	88_R	0.662	0.91
19_L	23_K	0.660	0.91
35_C	74_L	0.651	0.90
23_K	27_H	0.647	0.90
102_G	106_N	0.646	0.90
53_E	149_E	0.639	0.89
106_N	109_L	0.638	0.89
15_T	20_D	0.633	0.89
46_F	153_A	0.632	0.89
46_F	157_K	0.632	0.89
144_E	148_P	0.629	0.89
33_Y	68_E	0.628	0.88
5_A	116_F	0.626	0.88
143_S	148_P	0.620	0.88
39_N	44_P	0.616	0.88
39_N	133_K	0.615	0.87
92_A	119_M	0.615	0.87
10_S	39_N	0.608	0.87
47_S	157_K	0.605	0.87
54_L	149_E	0.602	0.86
14_V	58_V	0.602	0.86
7_C	32_V	0.600	0.86
49_E	69_T	0.599	0.86
39_N	129_S	0.597	0.86
84_K	112_S	0.597	0.86
21_I	87_L	0.595	0.86
34_V	59_T	0.594	0.86
22_I	26_A	0.593	0.85
40_S	102_G	0.593	0.85
74_L	102_G	0.588	0.85
132_V	135_V	0.587	0.85
149_E	153_A	0.585	0.85
6_V	81_K	0.585	0.85
130_S	133_K	0.575	0.84
108_V	127_L	0.575	0.84
92_A	126_F	0.574	0.84
50_E	153_A	0.565	0.83
68_E	80_R	0.564	0.83
7_C	21_I	0.562	0.82
136_A	142_V	0.560	0.82
107_R	121_N	0.558	0.82
131_I	135_V	0.556	0.82
108_V	123_Q	0.552	0.81
146_V	151_E	0.551	0.81
73_L	140_G	0.549	0.81
37_L	100_M	0.548	0.81
70_S	74_L	0.547	0.81
4_I	66_T	0.545	0.80
143_S	155_Q	0.544	0.80
146_V	154_L	0.543	0.80
41_S	137_R	0.543	0.80
3_S	28_I	0.540	0.80
133_K	136_A	0.537	0.79
16_Y	124_Y	0.535	0.79
27_H	31_Q	0.534	0.79
108_V	126_F	0.529	0.78
104_S	145_F	0.529	0.78
136_A	158_F	0.527	0.78
39_N	138_Y	0.525	0.78
108_V	122_N	0.522	0.77
75_I	106_N	0.521	0.77
6_V	74_L	0.518	0.77
75_I	109_L	0.513	0.76
14_V	54_L	0.511	0.76
88_R	120_T	0.509	0.76
93_V	101_Q	0.508	0.76
92_A	96_F	0.508	0.76
75_I	78_A	0.505	0.75
35_C	81_K	0.503	0.75
102_G	131_I	0.502	0.75
136_A	154_L	0.501	0.75
105_V	145_F	0.501	0.75
78_A	82_N	0.501	0.75
142_V	151_E	0.500	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vlhA	5	0.9752	100	0.468	Contact Map
3k9wA	5	1	100	0.471	Contact Map
3nbkA	5	0.9814	100	0.478	Contact Map
3nd5A	5	0.9379	100	0.481	Contact Map
4natA	5	0.9627	100	0.489	Contact Map
1o6bA	5	0.9938	100	0.49	Contact Map
1od6A	5	0.9503	100	0.491	Contact Map
3nv7A	4	0.9627	100	0.493	Contact Map
1qjcA	4	0.9752	100	0.494	Contact Map
4f3rA	5	0.9255	100	0.499	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.