PCRB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PCRB - Heptaprenylglyceryl phosphate synthase

UniProt:	O34790	Sequences: MYDVTEWKHVFKLDPNKDLPDEQLEILCESGTDAVIIGGSDGVTEDNVLRMMSKVRRFLVPCVLEVSAIEAIVPGFDLYFIPSVLNSKNADWIVGMHQKAMKEYGELMSMEEIVAEGYCIANPDCKAAALTEADADLNMDDIVAYARVSELLQLPIFYLEYSGVLGDIEAVKKTKAVLETSTLFYGGGIKDAETAKQYAEHADVIVVGNAVYEDFDRALKTVAAVKGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	228 (215)
Sequences:	639 (495)
Seq/√Len:	33.7

BACSU - PCRB
HALSA - GGGPS Q9HNW3
SULSO - GGGPS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
120_I	127_A	7.685	1.00
190_K	194_T	4.628	1.00
178_L	183_L	3.896	1.00
191_D	194_T	3.891	1.00
89_N	132_E	3.622	1.00
37_I	55_V	3.616	1.00
119_C	157_F	3.433	1.00
90_A	93_I	2.866	1.00
83_S	154_L	2.860	1.00
149_S	157_F	2.696	1.00
182_T	204_V	2.602	1.00
10_V	206_V	2.586	1.00
142_I	174_T	2.532	1.00
139_M	143_V	2.437	1.00
142_I	170_A	2.354	0.99
190_K	213_E	2.282	0.99
91_D	96_M	2.260	0.99
13_L	51_M	2.151	0.99
72_I	79_Y	2.149	0.99
150_E	181_S	2.142	0.99
66_V	81_I	2.077	0.98
128_A	135_A	2.064	0.98
36_I	80_F	2.032	0.98
37_I	52_M	2.005	0.98
41_D	126_K	1.988	0.98
20_P	23_Q	1.850	0.97
9_H	32_T	1.836	0.97
147_R	177_V	1.809	0.96
165_L	197_Q	1.771	0.96
23_Q	215_F	1.752	0.95
168_I	198_Y	1.744	0.95
156_I	184_F	1.738	0.95
16_N	41_D	1.734	0.95
16_N	42_G	1.697	0.95
195_A	205_I	1.692	0.95
147_R	151_L	1.684	0.94
192_A	196_K	1.668	0.94
99_K	138_N	1.628	0.93
45_E	73_V	1.625	0.93
102_K	141_D	1.622	0.93
214_D	217_R	1.620	0.93
217_R	220_K	1.618	0.93
122_N	136_D	1.610	0.93
143_V	173_K	1.540	0.91
117_G	154_L	1.513	0.90
37_I	62_C	1.509	0.90
165_L	198_Y	1.488	0.90
139_M	173_K	1.462	0.89
49_L	73_V	1.458	0.89
172_K	176_A	1.437	0.88
123_P	136_D	1.424	0.88
169_E	172_K	1.421	0.87
98_Q	148_V	1.410	0.87
184_F	206_V	1.407	0.87
80_F	116_E	1.398	0.87
48_V	64_L	1.390	0.86
49_L	75_G	1.384	0.86
90_A	95_G	1.371	0.85
10_V	34_A	1.363	0.85
27_L	35_V	1.360	0.85
10_V	36_I	1.352	0.85
83_S	152_L	1.345	0.84
171_V	198_Y	1.336	0.84
56_R	62_C	1.331	0.84
117_G	146_A	1.324	0.83
13_L	30_S	1.287	0.82
68_A	71_A	1.287	0.82
24_L	27_L	1.270	0.81
153_Q	201_H	1.269	0.81
191_D	197_Q	1.251	0.80
189_I	195_A	1.248	0.79
125_C	133_A	1.237	0.79
94_V	152_L	1.233	0.79
9_H	207_V	1.225	0.78
40_S	198_Y	1.204	0.77
167_D	198_Y	1.194	0.76
63_V	78_L	1.188	0.76
13_L	19_L	1.180	0.76
104_Y	113_I	1.164	0.75
52_M	56_R	1.163	0.74
53_S	75_G	1.161	0.74
78_L	114_V	1.153	0.74
114_V	191_D	1.149	0.74
24_L	54_K	1.147	0.73
82_P	131_T	1.132	0.72
120_I	133_A	1.119	0.72
143_V	177_V	1.118	0.71
64_L	174_T	1.061	0.67
11_F	32_T	1.051	0.67
54_K	57_R	1.050	0.67
191_D	205_I	1.041	0.66
143_V	175_K	1.036	0.65
215_F	219_L	1.012	0.64
210_A	217_R	1.011	0.64
11_F	211_V	1.006	0.63
94_V	101_M	0.996	0.62
145_Y	149_S	0.993	0.62
165_L	168_I	0.991	0.62
27_L	30_S	0.990	0.62
146_A	171_V	0.990	0.62
28_C	60_V	0.987	0.62
114_V	156_I	0.967	0.60
93_I	148_V	0.952	0.59
85_L	152_L	0.950	0.59
50_R	54_K	0.950	0.59
94_V	148_V	0.946	0.58
97_H	152_L	0.941	0.58
173_K	176_A	0.939	0.58
13_L	123_P	0.937	0.58
16_N	126_K	0.932	0.57
30_S	51_M	0.932	0.57
32_T	160_E	0.930	0.57
143_V	174_T	0.926	0.57
86_N	145_Y	0.921	0.56
85_L	117_G	0.920	0.56
55_V	59_L	0.916	0.56
209_N	212_Y	0.906	0.55
85_L	149_S	0.906	0.55
86_N	120_I	0.903	0.55
128_A	133_A	0.896	0.54
46_D	50_R	0.896	0.54
55_V	62_C	0.895	0.54
65_E	84_V	0.892	0.54
19_L	54_K	0.884	0.53
84_V	131_T	0.867	0.52
87_S	131_T	0.867	0.52
161_Y	166_G	0.863	0.51
158_Y	186_G	0.856	0.51
122_N	127_A	0.840	0.50
47_N	50_R	0.838	0.49
42_G	47_N	0.831	0.49
94_V	98_Q	0.831	0.49
170_A	201_H	0.830	0.49
168_I	197_Q	0.830	0.49
114_V	181_S	0.824	0.48
178_L	181_S	0.822	0.48
159_L	185_Y	0.810	0.47
72_I	104_Y	0.802	0.46
94_V	115_A	0.797	0.46
101_M	151_L	0.797	0.46
11_F	218_A	0.788	0.45
120_I	125_C	0.788	0.45
40_S	93_I	0.786	0.45
22_E	140_D	0.785	0.45
52_M	182_T	0.783	0.45
66_V	124_D	0.783	0.45
117_G	157_F	0.783	0.45
124_D	164_V	0.774	0.44
71_A	87_S	0.769	0.44
81_I	97_H	0.765	0.43
17_K	126_K	0.764	0.43
88_K	132_E	0.763	0.43
7_W	203_D	0.760	0.43
90_A	135_A	0.755	0.42
196_K	199_A	0.755	0.42
103_E	157_F	0.753	0.42
100_A	107_L	0.750	0.42
9_H	86_N	0.743	0.41
115_A	151_L	0.741	0.41
52_M	60_V	0.735	0.41
56_R	200_E	0.730	0.40
45_E	170_A	0.730	0.40
52_M	62_C	0.727	0.40
119_C	174_T	0.723	0.40
85_L	154_L	0.722	0.40
87_S	145_Y	0.722	0.40
83_S	170_A	0.717	0.39
176_A	179_E	0.716	0.39
150_E	204_V	0.715	0.39
32_T	60_V	0.714	0.39
45_E	142_I	0.713	0.39
46_D	53_S	0.712	0.39
46_D	172_K	0.711	0.39
213_E	216_D	0.710	0.39
83_S	93_I	0.705	0.38
102_K	144_A	0.701	0.38
93_I	124_D	0.699	0.38
48_V	106_E	0.697	0.38
48_V	61_P	0.696	0.38
153_Q	200_E	0.694	0.37
10_V	125_C	0.689	0.37
34_A	160_E	0.689	0.37
60_V	114_V	0.689	0.37
129_A	132_E	0.687	0.37
139_M	142_I	0.684	0.37
25_E	57_R	0.679	0.36
32_T	207_V	0.678	0.36
112_E	216_D	0.671	0.36
129_A	141_D	0.667	0.35
53_S	56_R	0.666	0.35
65_E	185_Y	0.666	0.35
37_I	60_V	0.665	0.35
153_Q	190_K	0.665	0.35
97_H	115_A	0.661	0.35
11_F	51_M	0.660	0.35
61_P	125_C	0.659	0.35
71_A	120_I	0.657	0.35
140_D	191_D	0.655	0.34
52_M	73_V	0.652	0.34
92_W	110_M	0.650	0.34
192_A	217_R	0.649	0.34
150_E	179_E	0.646	0.34
72_I	106_E	0.644	0.34
16_N	47_N	0.642	0.33
89_N	93_I	0.642	0.33
25_E	168_I	0.640	0.33
25_E	58_F	0.638	0.33
48_V	117_G	0.638	0.33
139_M	170_A	0.637	0.33
111_E	114_V	0.636	0.33
25_E	81_I	0.634	0.33
157_F	181_S	0.634	0.33
83_S	107_L	0.633	0.33
138_N	141_D	0.633	0.33
36_I	116_E	0.632	0.33
13_L	52_M	0.629	0.33
67_S	127_A	0.628	0.32
161_Y	185_Y	0.625	0.32
78_L	190_K	0.621	0.32
37_I	217_R	0.620	0.32
98_Q	164_V	0.620	0.32
89_N	206_V	0.619	0.32
100_A	157_F	0.616	0.32
124_D	206_V	0.613	0.31
27_L	193_E	0.608	0.31
159_L	174_T	0.607	0.31
56_R	157_F	0.607	0.31
86_N	133_A	0.605	0.31
121_A	170_A	0.603	0.31
99_K	102_K	0.603	0.31
58_F	62_C	0.602	0.31
117_G	203_D	0.601	0.30
104_Y	201_H	0.601	0.30
40_S	47_N	0.600	0.30
132_E	170_A	0.599	0.30
9_H	195_A	0.598	0.30
210_A	213_E	0.597	0.30
66_V	142_I	0.593	0.30
87_S	93_I	0.592	0.30
194_T	197_Q	0.592	0.30
151_L	213_E	0.591	0.30
20_P	203_D	0.588	0.30
69_I	125_C	0.579	0.29
141_D	144_A	0.579	0.29
22_E	177_V	0.578	0.29
115_A	149_S	0.578	0.29
178_L	182_T	0.577	0.29
87_S	133_A	0.575	0.29
129_A	138_N	0.572	0.28
78_L	182_T	0.572	0.28
23_Q	190_K	0.571	0.28
40_S	114_V	0.571	0.28
89_N	134_D	0.570	0.28
76_F	79_Y	0.570	0.28
175_K	193_E	0.570	0.28
6_E	179_E	0.569	0.28
34_A	63_V	0.567	0.28
69_I	96_M	0.566	0.28
123_P	217_R	0.565	0.28
97_H	144_A	0.564	0.28
106_E	147_R	0.563	0.28
143_V	170_A	0.561	0.28
32_T	222_V	0.560	0.28
69_I	100_A	0.559	0.28
105_G	147_R	0.557	0.27
98_Q	141_D	0.557	0.27
171_V	203_D	0.557	0.27
77_D	175_K	0.556	0.27
56_R	60_V	0.556	0.27
103_E	183_L	0.555	0.27
172_K	206_V	0.554	0.27
158_Y	163_G	0.554	0.27
30_S	155_P	0.554	0.27
55_V	114_V	0.553	0.27
25_E	85_L	0.551	0.27
68_A	89_N	0.551	0.27
30_S	219_L	0.549	0.27
35_V	79_Y	0.549	0.27
86_N	128_A	0.549	0.27
101_M	204_V	0.548	0.27
214_D	218_A	0.547	0.27
156_I	211_V	0.546	0.27
100_A	122_N	0.545	0.27
9_H	31_G	0.543	0.27
44_T	166_G	0.542	0.26
90_A	94_V	0.540	0.26
8_K	18_D	0.540	0.26
214_D	219_L	0.537	0.26
82_P	86_N	0.534	0.26
29_E	49_L	0.534	0.26
29_E	216_D	0.533	0.26
171_V	213_E	0.533	0.26
101_M	106_E	0.532	0.26
170_A	173_K	0.532	0.26
64_L	76_F	0.531	0.26
12_K	65_E	0.529	0.26
31_G	222_V	0.527	0.25
34_A	72_I	0.525	0.25
163_G	206_V	0.524	0.25
160_E	186_G	0.523	0.25
83_S	90_A	0.522	0.25
65_E	82_P	0.522	0.25
83_S	112_E	0.522	0.25
149_S	160_E	0.522	0.25
24_L	51_M	0.521	0.25
172_K	200_E	0.520	0.25
27_L	200_E	0.519	0.25
94_V	223_A	0.519	0.25
52_M	78_L	0.518	0.25
138_N	196_K	0.517	0.25
42_G	48_V	0.513	0.25
85_L	167_D	0.511	0.24
16_N	201_H	0.511	0.24
142_I	175_K	0.509	0.24
80_F	83_S	0.508	0.24
120_I	169_E	0.507	0.24
88_K	210_A	0.506	0.24
57_R	216_D	0.505	0.24
113_I	133_A	0.505	0.24
161_Y	164_V	0.503	0.24
63_V	80_F	0.501	0.24
86_N	131_T	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2f6uA	2	0.9737	100	0.562	Contact Map
3vzxA	2	1	100	0.574	Contact Map
3w01A	2	0.9956	100	0.589	Contact Map
4nafA	2	0.9737	100	0.642	Contact Map
3vk5A	2	0.9474	100	0.67	Contact Map
4mm1A	3	0.9605	100	0.678	Contact Map
3ktsA	1	0.7939	99.9	0.716	Contact Map
4jejA	2	0.9518	99.9	0.718	Contact Map
3thaA	2	0.8553	99.6	0.806	Contact Map
1ujpA	1	0.8202	99.5	0.82	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.