YJQB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJQB - UPF0714 protein YjqB

UniProt:	O34785	Sequences: MEDMYDSFAALSASESEYRIIYEEKNGSELIVLGPHGGRIEPGVSELVRAFSDRCSIYLFEGLKQRNNRSLHLTSIRFDEPLALEKVNDHHYALAFHGYYDPKIPHTLVGGADRKKAKLICERLNEAGFSAELTNEKDRLAGVHPNNIVNRTKREMGLQLEVSTAQRNALFRNFGCRDKSYIQNDLFDRYVEAVKLGFYT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	200 (190)
Sequences:	214 (184)
Seq/√Len:	13.4

BACSU - YJQB YMAC YNDL YOQZ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
107_T	190_Y	5.300	1.00
15_E	64_K	4.570	1.00
107_T	166_Q	4.064	1.00
93_A	152_T	3.986	1.00
166_Q	190_Y	3.628	0.99
62_G	68_N	3.121	0.98
64_K	70_S	3.086	0.97
99_Y	163_S	3.046	0.97
101_D	163_S	3.025	0.97
5_Y	15_E	2.839	0.96
35_P	108_L	2.739	0.95
33_L	87_V	2.561	0.92
58_Y	78_F	2.465	0.91
43_G	46_E	2.275	0.87
58_Y	80_E	2.212	0.85
33_L	83_A	2.153	0.84
113_D	154_R	2.123	0.83
34_G	44_V	2.117	0.83
35_P	137_K	2.083	0.82
39_R	67_N	2.063	0.81
35_P	95_A	2.058	0.81
45_S	61_E	2.002	0.79
31_I	93_A	1.952	0.77
73_L	78_F	1.945	0.77
35_P	48_V	1.891	0.75
10_A	14_S	1.842	0.73
34_G	48_V	1.809	0.71
108_L	137_K	1.768	0.69
8_F	73_L	1.761	0.69
136_E	194_V	1.753	0.69
5_Y	64_K	1.752	0.69
31_I	86_K	1.695	0.66
112_A	157_G	1.678	0.65
19_R	61_E	1.595	0.61
178_D	182_I	1.584	0.61
31_I	149_V	1.563	0.59
173_N	177_R	1.554	0.59
184_N	187_F	1.547	0.59
15_E	18_Y	1.539	0.58
77_R	145_P	1.517	0.57
56_S	90_H	1.464	0.54
149_V	157_G	1.462	0.54
179_K	182_I	1.454	0.54
64_K	73_L	1.452	0.54
3_D	74_T	1.384	0.50
79_D	128_G	1.381	0.50
32_V	50_A	1.371	0.49
50_A	191_V	1.357	0.49
120_I	158_L	1.348	0.48
174_F	184_N	1.332	0.47
175_G	182_I	1.314	0.46
31_I	90_H	1.300	0.46
121_C	131_A	1.289	0.45
53_D	195_K	1.286	0.45
83_A	148_I	1.273	0.44
182_I	193_A	1.256	0.43
170_L	184_N	1.252	0.43
94_L	116_K	1.230	0.42
58_Y	81_P	1.229	0.42
98_G	167_R	1.226	0.42
51_F	194_V	1.219	0.41
99_Y	129_F	1.214	0.41
52_S	57_I	1.163	0.39
32_V	45_S	1.160	0.38
116_K	158_L	1.144	0.38
120_I	124_L	1.143	0.38
78_F	81_P	1.140	0.37
9_A	73_L	1.136	0.37
30_L	155_E	1.135	0.37
34_G	52_S	1.131	0.37
7_S	77_R	1.100	0.35
142_G	159_Q	1.092	0.35
87_V	93_A	1.078	0.34
186_L	192_E	1.063	0.34
4_M	70_S	1.050	0.33
101_D	137_K	1.047	0.33
99_Y	108_L	1.044	0.33
183_Q	187_F	1.030	0.32
72_H	161_E	1.024	0.32
183_Q	188_D	1.016	0.32
10_A	67_N	1.005	0.31
118_K	160_L	0.998	0.31
64_K	163_S	0.995	0.31
20_I	80_E	0.992	0.30
108_L	131_A	0.987	0.30
32_V	146_N	0.987	0.30
30_L	94_L	0.981	0.30
175_G	178_D	0.980	0.30
186_L	196_L	0.971	0.29
124_L	129_F	0.962	0.29
188_D	191_V	0.959	0.29
44_V	48_V	0.957	0.29
175_G	179_K	0.955	0.29
99_Y	166_Q	0.942	0.28
165_A	169_A	0.937	0.28
117_A	133_L	0.934	0.28
45_S	142_G	0.928	0.28
7_S	73_L	0.926	0.28
101_D	165_A	0.924	0.27
58_Y	124_L	0.920	0.27
109_V	131_A	0.918	0.27
109_V	121_C	0.915	0.27
26_N	65_Q	0.913	0.27
185_D	189_R	0.913	0.27
100_Y	139_R	0.905	0.27
94_L	192_E	0.898	0.26
166_Q	169_A	0.891	0.26
45_S	59_L	0.890	0.26
96_F	190_Y	0.870	0.25
48_V	57_I	0.866	0.25
44_V	147_N	0.865	0.25
5_Y	43_G	0.858	0.25
50_A	151_R	0.851	0.24
8_F	154_R	0.849	0.24
107_T	120_I	0.845	0.24
55_C	170_L	0.841	0.24
192_E	196_L	0.838	0.24
74_T	97_H	0.834	0.24
51_F	96_F	0.831	0.24
85_E	107_T	0.827	0.24
34_G	57_I	0.826	0.24
92_Y	156_M	0.823	0.23
76_I	144_H	0.823	0.23
47_L	189_R	0.819	0.23
6_D	10_A	0.813	0.23
57_I	73_L	0.804	0.23
33_L	93_A	0.804	0.23
72_H	97_H	0.803	0.23
97_H	161_E	0.803	0.23
43_G	171_F	0.802	0.23
78_F	164_T	0.800	0.23
37_G	48_V	0.797	0.22
41_E	97_H	0.797	0.22
180_S	183_Q	0.797	0.22
177_R	182_I	0.789	0.22
107_T	160_L	0.785	0.22
70_S	73_L	0.782	0.22
181_Y	186_L	0.781	0.22
73_L	80_E	0.781	0.22
73_L	164_T	0.772	0.22
107_T	170_L	0.768	0.21
77_R	130_S	0.764	0.21
8_F	12_S	0.762	0.21
39_R	171_F	0.762	0.21
23_E	57_I	0.760	0.21
58_Y	73_L	0.760	0.21
116_K	157_G	0.748	0.21
170_L	178_D	0.746	0.21
187_F	195_K	0.741	0.20
136_E	162_V	0.740	0.20
140_L	164_T	0.737	0.20
84_L	151_R	0.736	0.20
183_Q	189_R	0.735	0.20
63_L	117_A	0.735	0.20
65_Q	165_A	0.732	0.20
8_F	78_F	0.729	0.20
93_A	166_Q	0.713	0.19
61_E	136_E	0.711	0.19
64_K	107_T	0.709	0.19
41_E	147_N	0.703	0.19
114_R	138_D	0.701	0.19
83_A	87_V	0.699	0.19
90_H	112_A	0.697	0.19
47_L	107_T	0.693	0.19
5_Y	100_Y	0.691	0.19
84_L	163_S	0.690	0.19
81_P	163_S	0.685	0.19
21_I	61_E	0.685	0.19
34_G	159_Q	0.683	0.19
12_S	96_F	0.683	0.19
39_R	68_N	0.683	0.19
75_S	177_R	0.674	0.18
45_S	151_R	0.673	0.18
176_C	179_K	0.672	0.18
52_S	151_R	0.668	0.18
22_Y	160_L	0.667	0.18
3_D	77_R	0.667	0.18
146_N	173_N	0.666	0.18
18_Y	64_K	0.661	0.18
62_G	71_L	0.660	0.18
51_F	95_A	0.656	0.18
8_F	183_Q	0.656	0.18
95_A	148_I	0.656	0.18
66_R	78_F	0.655	0.18
184_N	191_V	0.654	0.18
42_P	112_A	0.651	0.18
42_P	90_H	0.649	0.17
74_T	109_V	0.648	0.17
180_S	186_L	0.648	0.17
114_R	117_A	0.648	0.17
90_H	184_N	0.648	0.17
26_N	87_V	0.647	0.17
94_L	120_I	0.643	0.17
137_K	163_S	0.642	0.17
43_G	96_F	0.640	0.17
73_L	183_Q	0.639	0.17
9_A	96_F	0.635	0.17
3_D	28_S	0.635	0.17
43_G	107_T	0.634	0.17
27_G	35_P	0.632	0.17
30_L	196_L	0.631	0.17
186_L	190_Y	0.627	0.17
41_E	98_G	0.626	0.17
109_V	185_D	0.625	0.17
53_D	149_V	0.625	0.17
4_M	88_N	0.623	0.17
124_L	170_L	0.622	0.17
65_Q	120_I	0.621	0.17
40_I	167_R	0.618	0.17
94_L	194_V	0.617	0.16
21_I	77_R	0.615	0.16
121_C	140_L	0.611	0.16
182_I	186_L	0.608	0.16
61_E	94_L	0.605	0.16
140_L	193_A	0.604	0.16
19_R	62_G	0.604	0.16
86_K	127_A	0.603	0.16
139_R	151_R	0.602	0.16
40_I	62_G	0.601	0.16
73_L	109_V	0.598	0.16
39_R	162_V	0.593	0.16
47_L	96_F	0.593	0.16
24_E	79_D	0.592	0.16
105_P	186_L	0.591	0.16
21_I	49_R	0.591	0.16
19_R	139_R	0.589	0.16
131_A	162_V	0.588	0.16
60_F	147_N	0.588	0.16
8_F	187_F	0.582	0.15
45_S	57_I	0.582	0.15
87_V	90_H	0.581	0.15
23_E	151_R	0.578	0.15
18_Y	59_L	0.576	0.15
33_L	86_K	0.575	0.15
49_R	57_I	0.574	0.15
19_R	125_N	0.574	0.15
157_G	174_F	0.573	0.15
56_S	59_L	0.572	0.15
106_H	130_S	0.571	0.15
47_L	56_S	0.570	0.15
160_L	196_L	0.566	0.15
44_V	86_K	0.565	0.15
54_R	173_N	0.563	0.15
46_E	141_A	0.562	0.15
32_V	96_F	0.562	0.15
183_Q	191_V	0.560	0.15
57_I	157_G	0.559	0.15
68_N	170_L	0.558	0.15
87_V	142_G	0.554	0.15
8_F	58_Y	0.553	0.15
112_A	156_M	0.553	0.15
73_L	94_L	0.552	0.15
53_D	152_T	0.551	0.15
68_N	99_Y	0.551	0.15
8_F	18_Y	0.548	0.15
120_I	190_Y	0.548	0.15
39_R	152_T	0.548	0.15
73_L	96_F	0.545	0.14
130_S	162_V	0.543	0.14
32_V	51_F	0.542	0.14
186_L	189_R	0.538	0.14
19_R	32_V	0.538	0.14
97_H	147_N	0.536	0.14
101_D	175_G	0.535	0.14
67_N	175_G	0.534	0.14
39_R	66_R	0.532	0.14
47_L	170_L	0.532	0.14
10_A	100_Y	0.530	0.14
88_N	119_L	0.529	0.14
7_S	154_R	0.520	0.14
68_N	107_T	0.519	0.14
129_F	170_L	0.519	0.14
8_F	69_R	0.517	0.14
26_N	86_K	0.515	0.14
126_E	196_L	0.515	0.14
68_N	171_F	0.513	0.14
42_P	95_A	0.513	0.14
9_A	13_A	0.509	0.14
152_T	195_K	0.509	0.14
85_E	88_N	0.509	0.14
20_I	60_F	0.507	0.14
8_F	80_E	0.506	0.14
78_F	84_L	0.505	0.13
76_I	128_G	0.503	0.13
182_I	187_F	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3a9lA	2	0.975	100	0.145	Contact Map
2odfA	2	0.91	95.5	0.921	Contact Map
2q7sA	1	0.855	87.1	0.938	Contact Map
3qayA	1	0.76	32.9	0.959	Contact Map
3czxA	2	0.775	27.5	0.96	Contact Map
3iekA	3	0.625	23.7	0.961	Contact Map
3dkrA	1	0.385	18.6	0.963	Contact Map
4lq6A	1	0.79	18.6	0.963	Contact Map
3p9dF	2	0.86	18.3	0.963	Contact Map
2ki0A	1	0.18	17.1	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.