YOST - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOST - SPBc2 prophage-derived putative transcriptional regulator YosT

UniProt:	O34775	Sequences: MKITIEELPELRIAYFRNVGEYGGKQNKELMESFKKWAQLNGVFHNSVILGIPQDDPSITPKEECRYDVGVVLNEDFNVLQPAQVGKLPGGKYAVFLLDHTKEAVSEFWGNIFSEIEKNSLTMRGEPIIERYTSQMIDNHLCEVLVPIQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	149 (144)
Sequences:	1122 (845)
Seq/√Len:	70.4

ECOLI - SBMC YGIV
BACSU - YOST

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
97_L	143_E	3.905	1.00
12_R	85_V	3.337	1.00
92_K	121_L	3.032	1.00
55_D	66_R	2.676	1.00
61_P	64_E	2.553	1.00
10_E	90_G	2.534	1.00
13_I	70_G	2.412	1.00
16_F	30_L	2.327	1.00
121_L	148_I	2.315	1.00
17_R	68_D	2.313	1.00
37_W	83_A	2.258	1.00
10_E	87_K	2.191	1.00
131_R	143_E	2.181	1.00
99_D	141_L	1.972	1.00
48_V	131_R	1.944	1.00
15_Y	86_G	1.941	1.00
51_G	67_Y	1.892	1.00
116_I	119_N	1.889	1.00
34_F	38_A	1.841	1.00
48_V	72_V	1.832	1.00
21_E	62_K	1.770	1.00
53_P	67_Y	1.745	1.00
96_F	112_I	1.743	1.00
54_Q	86_G	1.742	1.00
50_L	131_R	1.727	1.00
100_H	142_C	1.708	1.00
89_P	126_E	1.688	1.00
26_Q	29_E	1.618	0.99
68_D	86_G	1.575	0.99
13_I	88_L	1.534	0.99
109_W	130_E	1.517	0.99
133_T	141_L	1.480	0.99
135_Q	138_D	1.459	0.99
51_G	69_V	1.445	0.99
22_Y	65_C	1.440	0.99
11_L	48_V	1.437	0.99
16_F	34_F	1.427	0.98
109_W	144_V	1.422	0.98
31_M	67_Y	1.400	0.98
38_A	71_V	1.394	0.98
53_P	130_E	1.375	0.98
14_A	73_L	1.361	0.98
30_L	69_V	1.360	0.98
129_I	145_L	1.351	0.98
15_Y	84_Q	1.340	0.98
14_A	83_A	1.318	0.97
112_I	146_V	1.311	0.97
97_L	141_L	1.306	0.97
54_Q	68_D	1.291	0.97
53_P	65_C	1.281	0.97
98_L	108_F	1.279	0.97
33_S	82_P	1.254	0.97
8_L	129_I	1.223	0.96
102_K	142_C	1.207	0.96
19_V	64_E	1.200	0.95
96_F	108_F	1.195	0.95
31_M	65_C	1.180	0.95
31_M	69_V	1.172	0.95
51_G	132_Y	1.147	0.94
108_F	144_V	1.122	0.94
27_N	69_V	1.111	0.93
27_N	67_Y	1.106	0.93
98_L	104_A	1.090	0.93
6_E	95_V	1.088	0.92
41_N	80_L	1.066	0.92
6_E	143_E	1.056	0.91
137_I	140_H	1.046	0.91
3_I	96_F	1.035	0.90
31_M	100_H	1.030	0.90
105_V	109_W	1.020	0.90
95_V	143_E	1.017	0.90
8_L	11_L	1.015	0.90
101_T	142_C	1.012	0.89
95_V	145_L	1.010	0.89
109_W	128_I	1.010	0.89
55_D	64_E	1.009	0.89
17_R	54_Q	1.009	0.89
79_V	85_V	1.007	0.89
29_E	33_S	0.997	0.89
16_F	33_S	0.993	0.89
7_E	92_K	0.975	0.88
31_M	53_P	0.967	0.87
100_H	105_V	0.961	0.87
91_G	124_R	0.958	0.87
19_V	55_D	0.938	0.86
34_F	71_V	0.930	0.85
124_R	145_L	0.923	0.85
113_F	116_I	0.916	0.84
116_I	123_M	0.911	0.84
134_S	139_N	0.909	0.84
27_N	31_M	0.905	0.83
16_F	83_A	0.896	0.83
3_I	112_I	0.895	0.83
115_E	118_K	0.873	0.81
6_E	145_L	0.861	0.80
30_L	34_F	0.861	0.80
134_S	142_C	0.854	0.80
55_D	130_E	0.840	0.79
102_K	132_Y	0.837	0.78
18_N	27_N	0.835	0.78
31_M	49_I	0.833	0.78
113_F	123_M	0.818	0.77
131_R	145_L	0.809	0.76
44_F	47_S	0.807	0.76
15_Y	81_Q	0.807	0.76
136_M	139_N	0.806	0.76
56_D	59_I	0.797	0.75
17_R	21_E	0.791	0.74
67_Y	105_V	0.791	0.74
117_E	120_S	0.789	0.74
73_L	76_D	0.782	0.73
32_E	36_K	0.776	0.73
70_G	138_D	0.762	0.72
104_A	107_E	0.759	0.71
88_L	107_E	0.757	0.71
81_Q	84_Q	0.756	0.71
33_S	64_E	0.753	0.71
93_Y	126_E	0.749	0.70
19_V	66_R	0.747	0.70
22_Y	55_D	0.739	0.69
43_V	78_N	0.729	0.68
12_R	76_D	0.725	0.68
7_E	90_G	0.725	0.68
99_D	133_T	0.723	0.68
13_I	86_G	0.720	0.67
65_C	69_V	0.719	0.67
3_I	119_N	0.712	0.66
93_Y	129_I	0.711	0.66
36_K	40_L	0.702	0.65
107_E	111_N	0.695	0.64
47_S	72_V	0.686	0.63
110_G	114_S	0.680	0.63
28_K	32_E	0.678	0.63
53_P	104_A	0.678	0.63
29_E	118_K	0.677	0.62
111_N	115_E	0.677	0.62
55_D	109_W	0.677	0.62
52_I	147_P	0.671	0.62
41_N	78_N	0.665	0.61
47_S	71_V	0.664	0.61
54_Q	60_T	0.661	0.61
38_A	44_F	0.659	0.60
102_K	134_S	0.655	0.60
53_P	129_I	0.655	0.60
8_L	145_L	0.649	0.59
14_A	37_W	0.649	0.59
13_I	50_L	0.646	0.59
137_I	143_E	0.645	0.59
102_K	105_V	0.642	0.58
15_Y	68_D	0.641	0.58
8_L	93_Y	0.640	0.58
11_L	88_L	0.639	0.58
105_V	142_C	0.634	0.57
14_A	35_K	0.634	0.57
29_E	32_E	0.633	0.57
18_N	28_K	0.623	0.56
136_M	140_H	0.618	0.56
34_F	69_V	0.612	0.55
8_L	120_S	0.611	0.55
15_Y	69_V	0.610	0.55
14_A	95_V	0.609	0.54
10_E	89_P	0.609	0.54
100_H	109_W	0.607	0.54
105_V	122_T	0.606	0.54
97_L	129_I	0.605	0.54
69_V	135_Q	0.601	0.53
52_I	70_G	0.598	0.53
14_A	71_V	0.597	0.53
18_N	30_L	0.596	0.53
51_G	127_P	0.594	0.53
68_D	90_G	0.594	0.53
42_G	89_P	0.591	0.52
94_A	116_I	0.587	0.52
33_S	119_N	0.585	0.52
3_I	117_E	0.584	0.51
4_T	79_V	0.579	0.51
32_E	41_N	0.574	0.50
74_N	77_F	0.573	0.50
122_T	127_P	0.572	0.50
12_R	73_L	0.571	0.50
27_N	35_K	0.569	0.50
75_E	120_S	0.568	0.49
66_R	130_E	0.566	0.49
94_A	119_N	0.562	0.49
89_P	93_Y	0.559	0.48
56_D	111_N	0.558	0.48
31_M	102_K	0.556	0.48
106_S	122_T	0.553	0.48
53_P	132_Y	0.553	0.48
12_R	122_T	0.553	0.48
22_Y	109_W	0.547	0.47
17_R	86_G	0.545	0.47
100_H	139_N	0.543	0.46
107_E	114_S	0.541	0.46
39_Q	44_F	0.541	0.46
75_E	90_G	0.540	0.46
73_L	85_V	0.539	0.46
73_L	77_F	0.533	0.45
77_F	88_L	0.529	0.45
18_N	69_V	0.526	0.44
15_Y	70_G	0.526	0.44
104_A	148_I	0.523	0.44
4_T	44_F	0.522	0.44
32_E	95_V	0.522	0.44
9_P	12_R	0.521	0.44
98_L	143_E	0.519	0.44
37_W	41_N	0.519	0.44
70_G	79_V	0.517	0.43
18_N	51_G	0.513	0.43
4_T	95_V	0.512	0.43
21_E	56_D	0.512	0.43
62_K	80_L	0.509	0.42
133_T	142_C	0.506	0.42
9_P	21_E	0.505	0.42
57_P	66_R	0.503	0.42
130_E	142_C	0.500	0.41

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jyhA	1	0.9866	100	0.341	Contact Map
3b49A	1	1	100	0.351	Contact Map
3gk6A	1	0.9329	100	0.405	Contact Map
3lurA	1	0.9664	100	0.432	Contact Map
3e0hA	1	0.9664	99.9	0.449	Contact Map
1r8eA	2	0.9799	99.9	0.463	Contact Map
1d5yA	1	0.9866	99.9	0.479	Contact Map
4b0yA	1	0.9463	98.7	0.77	Contact Map
2govA	1	0.9799	97.2	0.838	Contact Map
3r8jA	1	0.9799	97	0.844	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.