FLAV - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLAV - Probable flavodoxin-1

UniProt:	O34737	Sequences: MAKALITYASMSGNTEDIAFIIKDTLQEYELDIDCVEINDMDASCLTSYDYVLIGTYTWGDGDLPYEAEDFFEEVKQIQLNGLKTACFGSGDYSYPKFCEAVNLFNVMLQEAGAAVYQETLKIELAPETDEDVESCRAFARGFLAWADYMNKEKIHVS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	158 (140)
Sequences:	4250 (2874)
Seq/√Len:	242.9

ECOLI - YQCA CYSJ MIOC FLAV FLAW
BACSU - FLAV FLAW CYSJ CYPD CYPE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
106_N	116_V	3.928	1.00
89_G	102_V	3.642	1.00
103_N	122_K	3.382	1.00
11_M	66_Y	2.769	1.00
84_K	115_A	2.736	1.00
110_Q	116_V	2.680	1.00
108_M	111_E	2.425	1.00
100_E	104_L	2.389	1.00
108_M	112_A	2.279	1.00
85_T	106_N	2.214	1.00
23_K	35_C	2.130	1.00
88_F	123_I	2.059	1.00
85_T	110_Q	1.951	1.00
4_A	26_L	1.942	1.00
64_L	101_A	1.925	1.00
41_M	49_Y	1.921	1.00
26_L	144_L	1.867	1.00
6_I	23_K	1.777	1.00
7_T	38_I	1.741	1.00
87_C	102_V	1.732	1.00
51_Y	84_K	1.719	1.00
16_E	20_F	1.658	1.00
9_A	68_A	1.647	1.00
118_Q	142_G	1.638	1.00
106_N	120_T	1.615	1.00
85_T	116_V	1.597	1.00
38_I	71_F	1.581	1.00
15_T	55_G	1.537	1.00
106_N	110_Q	1.532	1.00
85_T	114_A	1.493	1.00
54_I	105_F	1.461	1.00
60_G	63_D	1.458	1.00
23_K	33_I	1.455	1.00
23_K	27_Q	1.442	1.00
56_T	105_F	1.429	1.00
54_I	109_L	1.419	1.00
7_T	41_M	1.419	1.00
53_L	143_F	1.412	1.00
18_I	136_C	1.407	1.00
76_K	108_M	1.389	1.00
9_A	56_T	1.387	1.00
10_S	67_E	1.376	1.00
3_K	32_D	1.353	1.00
103_N	120_T	1.333	1.00
72_F	105_F	1.316	1.00
109_L	114_A	1.278	1.00
72_F	104_L	1.269	1.00
15_T	90_S	1.259	1.00
53_L	86_A	1.258	1.00
18_I	90_S	1.251	1.00
71_F	105_F	1.216	1.00
52_V	83_L	1.208	1.00
99_C	122_K	1.186	1.00
5_L	36_V	1.161	1.00
86_A	118_Q	1.128	1.00
22_I	55_G	1.115	1.00
20_F	35_C	1.100	1.00
88_F	136_C	1.074	1.00
72_F	108_M	1.066	1.00
25_T	140_A	1.065	1.00
9_A	67_E	1.062	1.00
116_V	119_E	1.054	1.00
89_G	99_C	1.047	1.00
107_V	111_E	1.046	1.00
38_I	68_A	1.043	1.00
22_I	140_A	1.037	1.00
118_Q	143_F	1.027	1.00
100_E	103_N	1.025	1.00
88_F	121_L	1.024	1.00
34_D	49_Y	1.014	1.00
57_Y	65_P	1.007	1.00
37_E	67_E	1.006	1.00
123_I	136_C	1.005	1.00
37_E	40_D	0.973	1.00
86_A	143_F	0.972	1.00
56_T	68_A	0.968	1.00
56_T	101_A	0.965	1.00
26_L	33_I	0.957	1.00
64_L	68_A	0.954	1.00
58_T	99_C	0.942	1.00
72_F	101_A	0.921	1.00
99_C	102_V	0.920	1.00
7_T	52_V	0.917	1.00
64_L	72_F	0.914	1.00
61_D	97_K	0.911	1.00
142_G	145_A	0.909	1.00
138_A	141_R	0.909	1.00
82_G	115_A	0.895	1.00
8_Y	16_E	0.893	1.00
25_T	29_Y	0.881	0.99
138_A	142_G	0.868	0.99
55_G	88_F	0.868	0.99
25_T	141_R	0.865	0.99
3_K	34_D	0.861	0.99
74_E	78_I	0.860	0.99
141_R	145_A	0.854	0.99
49_Y	52_V	0.842	0.99
56_T	65_P	0.835	0.99
5_L	49_Y	0.821	0.99
116_V	120_T	0.820	0.99
86_A	117_Y	0.820	0.99
11_M	15_T	0.816	0.99
118_Q	121_L	0.816	0.99
22_I	53_L	0.812	0.99
118_Q	146_W	0.809	0.99
4_A	31_L	0.803	0.99
9_A	65_P	0.800	0.99
12_S	61_D	0.795	0.99
80_L	114_A	0.790	0.99
24_D	27_Q	0.789	0.99
5_L	34_D	0.788	0.99
42_D	45_C	0.787	0.99
66_Y	69_E	0.785	0.99
36_V	40_D	0.783	0.99
39_N	67_E	0.776	0.99
41_M	74_E	0.775	0.99
10_S	15_T	0.772	0.99
17_D	21_I	0.768	0.99
4_A	51_Y	0.760	0.98
72_F	76_K	0.759	0.98
21_I	137_R	0.757	0.98
102_V	120_T	0.757	0.98
18_I	55_G	0.755	0.98
119_E	142_G	0.752	0.98
3_K	50_D	0.750	0.98
85_T	109_L	0.735	0.98
31_L	51_Y	0.733	0.98
16_E	67_E	0.728	0.98
25_T	137_R	0.725	0.98
73_E	77_Q	0.721	0.98
9_A	38_I	0.720	0.98
123_I	127_P	0.712	0.98
12_S	125_L	0.710	0.98
107_V	110_Q	0.706	0.98
136_C	140_A	0.698	0.97
5_L	50_D	0.697	0.97
87_C	106_N	0.688	0.97
76_K	104_L	0.685	0.97
7_T	36_V	0.675	0.97
91_G	99_C	0.671	0.97
135_S	138_A	0.652	0.96
43_A	74_E	0.651	0.96
97_K	100_E	0.649	0.96
58_T	102_V	0.648	0.96
83_L	109_L	0.647	0.96
24_D	28_E	0.642	0.96
10_S	17_D	0.642	0.96
64_L	104_L	0.638	0.96
56_T	102_V	0.637	0.96
27_Q	33_I	0.634	0.95
8_Y	35_C	0.629	0.95
15_T	57_Y	0.627	0.95
62_G	65_P	0.624	0.95
121_L	135_S	0.623	0.95
7_T	54_I	0.622	0.95
84_K	117_Y	0.617	0.95
4_A	53_L	0.617	0.95
59_W	125_L	0.615	0.95
79_Q	112_A	0.614	0.95
6_I	19_A	0.601	0.94
46_L	52_V	0.599	0.94
91_G	95_Y	0.598	0.94
78_I	112_A	0.595	0.94
93_Y	126_A	0.594	0.94
60_G	90_S	0.594	0.94
42_D	77_Q	0.593	0.94
63_D	104_L	0.591	0.93
137_R	141_R	0.590	0.93
44_S	78_I	0.586	0.93
92_D	95_Y	0.585	0.93
25_T	144_L	0.571	0.92
90_S	125_L	0.570	0.92
88_F	143_F	0.570	0.92
17_D	20_F	0.569	0.92
45_C	48_S	0.569	0.92
102_V	122_K	0.568	0.92
51_Y	147_A	0.567	0.92
93_Y	124_E	0.561	0.92
136_C	139_F	0.558	0.91
29_Y	144_L	0.557	0.91
123_I	135_S	0.551	0.91
64_L	105_F	0.549	0.91
9_A	101_A	0.545	0.90
39_N	43_A	0.543	0.90
12_S	59_W	0.543	0.90
48_S	115_A	0.543	0.90
95_Y	99_C	0.540	0.90
6_I	35_C	0.537	0.90
19_A	35_C	0.536	0.90
6_I	26_L	0.535	0.90
8_Y	55_G	0.532	0.89
24_D	29_Y	0.529	0.89
8_Y	37_E	0.525	0.89
9_A	59_W	0.525	0.89
6_I	50_D	0.525	0.89
48_S	82_G	0.524	0.89
92_D	126_A	0.522	0.88
36_V	41_M	0.522	0.88
3_K	49_Y	0.522	0.88
143_F	147_A	0.518	0.88
104_L	107_V	0.515	0.88
98_F	120_T	0.510	0.87
75_V	112_A	0.509	0.87
90_S	139_F	0.506	0.87
79_Q	82_G	0.505	0.87
9_A	124_E	0.504	0.87
12_S	126_A	0.503	0.87
54_I	65_P	0.503	0.87
33_I	36_V	0.501	0.86
22_I	89_G	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1tllA	2	0.9747	100	0.165	Contact Map
2bpoA	1	0.9873	100	0.228	Contact Map
3qe2A	1	0.981	100	0.231	Contact Map
3hr4A	2	0.9747	100	0.294	Contact Map
1bvyF	1	0.9367	100	0.371	Contact Map
4h2dA	1	0.9684	100	0.388	Contact Map
1ykgA	1	0.9051	100	0.404	Contact Map
4oxxA	1	0.943	100	0.412	Contact Map
2m6rA	1	0.9177	100	0.424	Contact Map
2hnaA	1	0.9177	100	0.426	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.