YVLC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVLC - Uncharacterized membrane protein YvlC

UniProt:	O34719	Sequences: MNKLYRSEKNKKIAGVIGGLAEYFNWDASLLRVITVILAIMTSVLPVLLIYIIWIFIVPSERDMK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	65 (58)
Sequences:	418 (338)
Seq/√Len:	44.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
14_A	55_I	4.108	1.00
7_S	18_G	3.664	1.00
54_W	58_V	2.373	1.00
10_N	28_A	2.102	0.99
8_E	60_S	2.051	0.99
6_R	55_I	1.998	0.99
17_I	31_L	1.908	0.99
43_S	47_V	1.704	0.98
39_A	47_V	1.700	0.98
39_A	48_L	1.612	0.97
8_E	61_E	1.607	0.97
7_S	22_E	1.538	0.96
53_I	57_I	1.512	0.95
22_E	61_E	1.501	0.95
33_V	54_W	1.471	0.95
4_L	58_V	1.384	0.93
29_S	33_V	1.355	0.92
11_K	60_S	1.342	0.91
52_I	56_F	1.327	0.91
10_N	18_G	1.323	0.91
9_K	61_E	1.294	0.90
12_K	56_F	1.280	0.89
6_R	14_A	1.264	0.89
17_I	35_T	1.177	0.85
35_T	54_W	1.136	0.83
3_K	42_T	1.093	0.80
12_K	29_S	1.061	0.78
5_Y	58_V	1.054	0.78
35_T	50_I	1.052	0.77
35_T	39_A	1.023	0.75
36_V	39_A	1.007	0.74
8_E	11_K	0.997	0.74
18_G	22_E	0.929	0.68
21_A	28_A	0.892	0.65
5_Y	22_E	0.879	0.64
17_I	28_A	0.874	0.63
28_A	50_I	0.861	0.62
3_K	28_A	0.857	0.62
40_I	43_S	0.838	0.60
5_Y	53_I	0.837	0.60
38_L	52_I	0.829	0.59
2_N	23_Y	0.820	0.58
7_S	10_N	0.812	0.58
18_G	28_A	0.811	0.58
42_T	48_L	0.808	0.57
13_I	49_L	0.798	0.56
10_N	30_L	0.742	0.51
30_L	34_I	0.735	0.50
11_K	49_L	0.721	0.49
44_V	49_L	0.712	0.48
2_N	40_I	0.710	0.48
29_S	58_V	0.684	0.45
9_K	36_V	0.673	0.44
38_L	61_E	0.667	0.44
14_A	22_E	0.660	0.43
8_E	54_W	0.657	0.43
47_V	54_W	0.653	0.42
3_K	30_L	0.628	0.40
5_Y	14_A	0.618	0.39
12_K	55_I	0.617	0.39
29_S	57_I	0.611	0.39
34_I	54_W	0.602	0.38
41_M	53_I	0.590	0.37
47_V	52_I	0.581	0.36
8_E	22_E	0.572	0.35
44_V	50_I	0.571	0.35
9_K	54_W	0.569	0.35
25_N	57_I	0.569	0.35
20_L	23_Y	0.560	0.34
9_K	18_G	0.555	0.34
10_N	37_I	0.554	0.33
25_N	43_S	0.550	0.33
12_K	57_I	0.542	0.32
39_A	44_V	0.537	0.32
3_K	29_S	0.532	0.32
38_L	42_T	0.531	0.32
3_K	59_P	0.527	0.31
37_I	43_S	0.524	0.31
43_S	57_I	0.516	0.30
9_K	24_F	0.514	0.30
26_W	30_L	0.512	0.30
21_A	41_M	0.511	0.30
13_I	27_D	0.509	0.30
35_T	44_V	0.508	0.30
5_Y	36_V	0.508	0.30
37_I	49_L	0.506	0.29
2_N	11_K	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3czxA	2	0.4308	14	0.899	Contact Map
3qe7A	2	0.8154	13.1	0.9	Contact Map
3orgA	2	0.8154	10	0.905	Contact Map
3l51B	1	0.8154	7.9	0.909	Contact Map
1jwqA	1	0.4154	7.4	0.911	Contact Map
4binA	1	0.3846	7.1	0.911	Contact Map
3nd0A	2	1	6.8	0.912	Contact Map
3ibzA	1	0.4308	6.7	0.912	Contact Map
4i5sA	2	0.2923	6.3	0.913	Contact Map
4lqxA	2	0.4923	5	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.