YTOA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTOA - Uncharacterized transferase YtoA

UniProt:	O34696	Sequences: MIYPYKEHKPDIHPTAFIADNATITGDVVIGEQSSIWFSVVIRGDVAPTRIGNRVNIQDLSCLHQSPNKTLLIEDDATIGHQVTLHSAVIRKNALIGMGSIILDGAEIGEGAFIGAGSLVPPGKIIPPGHLAFGRPAKVIRPLTEEDRKDMQRIRSEYVEKGQYYKFLQQT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (146)
Sequences:	8095 (5023)
Seq/√Len:	415.7

ECOLI - YRDA CAIE PAAY THGA LPXA WBBJ WCAF LPXD MAA YAIX WCAB GLMU
BACSU - YTOA DAPH EPSM MAA YVOF CYSE GLMU
HALSA - Q9HQ06 Q9HPT3 Q9HNN1
SULSO - Q980E1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_R	76_D	3.454	1.00
33_Q	54_R	3.331	1.00
53_N	75_D	2.897	1.00
93_N	111_G	2.841	1.00
32_E	53_N	2.772	1.00
63_L	71_L	2.732	1.00
126_I	132_A	2.706	1.00
91_R	110_E	2.577	1.00
31_G	53_N	2.371	1.00
107_E	125_I	2.290	1.00
76_D	93_N	2.231	1.00
115_G	133_F	2.203	1.00
13_H	32_E	2.186	1.00
29_V	50_R	2.172	1.00
74_E	92_K	2.171	1.00
111_G	129_G	2.160	1.00
92_K	110_E	2.157	1.00
110_E	128_P	2.124	1.00
91_R	107_E	1.922	1.00
75_D	92_K	1.848	1.00
121_P	124_K	1.824	1.00
15_T	33_Q	1.774	1.00
89_V	107_E	1.751	1.00
27_D	48_P	1.714	1.00
50_R	72_L	1.644	1.00
72_L	89_V	1.615	1.00
109_G	128_P	1.575	1.00
52_G	75_D	1.570	1.00
39_S	60_L	1.473	1.00
133_F	140_I	1.471	1.00
157_E	162_G	1.468	1.00
34_S	75_D	1.440	1.00
60_L	82_Q	1.431	1.00
109_G	125_I	1.428	1.00
118_S	137_A	1.420	1.00
127_P	130_H	1.411	1.00
144_T	147_D	1.389	1.00
139_V	142_P	1.386	1.00
85_L	88_A	1.375	1.00
127_P	139_V	1.336	1.00
132_A	139_V	1.321	1.00
34_S	55_V	1.321	1.00
57_I	61_S	1.315	1.00
130_H	139_V	1.311	1.00
90_I	94_A	1.305	1.00
112_A	130_H	1.273	1.00
55_V	77_A	1.271	1.00
62_C	82_Q	1.261	1.00
14_P	32_E	1.258	1.00
114_I	120_V	1.250	1.00
19_A	38_F	1.215	1.00
29_V	48_P	1.181	1.00
21_N	39_S	1.174	1.00
31_G	50_R	1.171	1.00
109_G	127_P	1.131	1.00
15_T	32_E	1.121	1.00
82_Q	99_G	1.120	1.00
102_I	106_A	1.115	1.00
40_V	61_S	1.112	1.00
30_I	36_I	1.109	1.00
94_A	128_P	1.107	1.00
42_I	49_T	1.102	1.00
117_G	135_R	1.086	1.00
112_A	128_P	1.084	1.00
74_E	91_R	1.073	1.00
96_I	102_I	1.072	1.00
130_H	142_P	1.067	1.00
55_V	92_K	1.058	1.00
34_S	53_N	1.045	1.00
95_L	113_F	1.043	1.00
94_A	112_A	1.040	1.00
28_V	42_I	1.035	1.00
101_I	117_G	1.033	1.00
73_I	77_A	1.015	1.00
153_R	156_S	1.015	1.00
132_A	137_A	1.010	1.00
129_G	148_R	0.993	1.00
30_I	34_S	0.976	1.00
24_I	28_V	0.951	1.00
55_V	75_D	0.950	1.00
149_K	152_Q	0.945	1.00
54_R	159_V	0.934	1.00
61_S	83_V	0.932	1.00
16_A	34_S	0.929	1.00
12_I	16_A	0.928	1.00
52_G	72_L	0.917	1.00
57_I	63_L	0.911	1.00
154_I	158_Y	0.908	1.00
108_I	112_A	0.900	1.00
103_L	106_A	0.896	1.00
96_I	114_I	0.894	1.00
120_V	137_A	0.890	1.00
36_I	40_V	0.878	1.00
119_L	135_R	0.876	1.00
71_L	85_L	0.874	1.00
18_I	22_A	0.874	1.00
79_I	83_V	0.873	1.00
141_R	147_D	0.871	1.00
57_I	79_I	0.865	1.00
74_E	89_V	0.851	1.00
100_S	114_I	0.849	1.00
73_I	79_I	0.841	1.00
153_R	157_E	0.834	1.00
31_G	75_D	0.831	1.00
79_I	85_L	0.820	1.00
127_P	132_A	0.811	1.00
103_L	116_A	0.809	1.00
112_A	126_I	0.792	1.00
51_I	55_V	0.790	1.00
106_A	125_I	0.783	1.00
36_I	42_I	0.779	1.00
85_L	90_I	0.778	1.00
84_T	98_M	0.775	1.00
101_I	119_L	0.765	1.00
66_S	104_D	0.763	1.00
157_E	160_E	0.760	1.00
55_V	73_I	0.757	1.00
13_H	16_A	0.756	1.00
154_I	157_E	0.755	1.00
91_R	128_P	0.749	1.00
56_N	78_T	0.749	1.00
156_S	160_E	0.749	1.00
118_S	135_R	0.748	1.00
94_A	110_E	0.744	1.00
31_G	52_G	0.743	1.00
131_L	143_L	0.738	1.00
103_L	119_L	0.737	1.00
114_I	132_A	0.734	1.00
23_T	39_S	0.733	1.00
114_I	126_I	0.730	1.00
77_A	94_A	0.726	1.00
99_G	117_G	0.726	1.00
134_G	137_A	0.713	1.00
109_G	112_A	0.712	1.00
90_I	96_I	0.711	1.00
77_A	92_K	0.710	1.00
159_V	163_Q	0.706	1.00
152_Q	156_S	0.703	1.00
159_V	162_G	0.690	1.00
111_G	152_Q	0.688	1.00
96_I	100_S	0.686	1.00
54_R	75_D	0.673	1.00
129_G	142_P	0.673	1.00
33_Q	53_N	0.660	0.99
87_S	104_D	0.659	0.99
101_I	116_A	0.658	0.99
84_T	99_G	0.653	0.99
52_G	55_V	0.652	0.99
46_V	65_Q	0.652	0.99
160_E	163_Q	0.639	0.99
155_R	158_Y	0.638	0.99
111_G	148_R	0.637	0.99
88_A	106_A	0.636	0.99
77_A	110_E	0.635	0.99
106_A	120_V	0.629	0.99
151_M	154_I	0.627	0.99
21_N	38_F	0.626	0.99
150_D	153_R	0.625	0.99
13_H	31_G	0.625	0.99
86_H	104_D	0.625	0.99
47_A	65_Q	0.624	0.99
145_E	148_R	0.623	0.99
102_I	108_I	0.620	0.99
58_Q	81_H	0.617	0.99
91_R	109_G	0.609	0.99
145_E	149_K	0.603	0.99
113_F	131_L	0.602	0.99
16_A	53_N	0.601	0.99
41_V	60_L	0.600	0.99
77_A	90_I	0.599	0.99
17_F	20_D	0.596	0.99
13_H	53_N	0.587	0.99
81_H	98_M	0.587	0.99
119_L	133_F	0.587	0.99
93_N	110_E	0.586	0.99
36_I	57_I	0.585	0.99
51_I	57_I	0.585	0.99
76_D	152_Q	0.582	0.99
149_K	153_R	0.579	0.99
143_L	147_D	0.579	0.99
131_L	141_R	0.577	0.98
91_R	94_A	0.575	0.98
24_I	30_I	0.571	0.98
83_V	100_S	0.571	0.98
37_W	43_R	0.571	0.98
121_P	135_R	0.569	0.98
59_D	81_H	0.568	0.98
78_T	154_I	0.566	0.98
150_D	154_I	0.562	0.98
42_I	63_L	0.562	0.98
147_D	150_D	0.562	0.98
100_S	118_S	0.561	0.98
91_R	112_A	0.561	0.98
71_L	86_H	0.561	0.98
23_T	38_F	0.555	0.98
157_E	161_K	0.555	0.98
155_R	159_V	0.553	0.98
16_A	30_I	0.552	0.98
143_L	148_R	0.549	0.98
85_L	102_I	0.548	0.98
144_T	148_R	0.545	0.98
121_P	137_A	0.540	0.98
12_I	30_I	0.535	0.98
93_N	152_Q	0.531	0.97
47_A	66_S	0.529	0.97
93_N	151_M	0.527	0.97
43_R	64_H	0.526	0.97
59_D	62_C	0.525	0.97
146_E	149_K	0.522	0.97
98_M	101_I	0.521	0.97
64_H	86_H	0.521	0.97
80_G	86_H	0.520	0.97
12_I	24_I	0.519	0.97
156_S	159_V	0.517	0.97
59_D	64_H	0.517	0.97
31_G	34_S	0.516	0.97
46_V	157_E	0.515	0.97
23_T	41_V	0.511	0.97
42_I	51_I	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xhdA	3	0.9883	100	0.261	Contact Map
1v3wA	3	1	100	0.282	Contact Map
3r3rA	3	1	100	0.283	Contact Map
3ixcA	3	0.9474	100	0.285	Contact Map
3r1wA	3	1	100	0.29	Contact Map
4mfgA	3	0.9649	100	0.295	Contact Map
4n27A	3	1	100	0.31	Contact Map
1j2zA	3	0.9766	100	0.339	Contact Map
4r36A	3	0.9883	100	0.342	Contact Map
3r0sA	3	0.9474	100	0.345	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.