YTNI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTNI - Putative glutaredoxin YtnI

UniProt:	O34639	Sequences: MSDVVNIVVWSKKGCSYCEEVKNYLNEKGFPFQNIDVSEKEKLRDILQVKYGVRHVPVVEIGRGNQYQGITEIGIEHLDLALANHAQIKEAKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	93 (75)
Sequences:	177 (136)
Seq/√Len:	15.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_V	25_L	3.746	1.00
46_I	50_K	3.135	0.99
23_N	27_E	2.866	0.98
51_Y	60_E	2.575	0.95
53_V	58_V	2.442	0.94
26_N	32_F	2.285	0.91
48_Q	54_R	2.262	0.91
7_I	30_F	2.178	0.89
45_D	54_R	2.123	0.88
71_T	74_G	2.090	0.87
70_I	73_I	1.833	0.79
45_D	48_Q	1.827	0.78
27_E	62_G	1.787	0.77
21_V	78_L	1.758	0.75
35_I	52_G	1.623	0.69
72_E	76_E	1.569	0.67
13_K	63_R	1.451	0.60
69_G	74_G	1.407	0.58
7_I	38_S	1.372	0.56
31_P	78_L	1.313	0.53
12_K	56_V	1.305	0.52
52_G	78_L	1.298	0.52
3_D	63_R	1.271	0.50
20_E	76_E	1.262	0.50
6_N	31_P	1.237	0.48
6_N	62_G	1.176	0.45
26_N	69_G	1.156	0.44
69_G	72_E	1.117	0.41
18_C	56_V	1.099	0.40
23_N	48_Q	1.093	0.40
70_I	74_G	1.090	0.40
21_V	59_V	1.090	0.40
4_V	27_E	1.007	0.35
30_F	39_E	0.990	0.35
61_I	64_G	0.967	0.33
4_V	42_K	0.964	0.33
14_G	55_H	0.964	0.33
46_I	69_G	0.948	0.32
9_V	72_E	0.948	0.32
22_K	36_D	0.946	0.32
53_V	65_N	0.943	0.32
5_V	40_K	0.927	0.31
21_V	72_E	0.924	0.31
3_D	13_K	0.922	0.31
37_V	44_R	0.908	0.30
69_G	73_I	0.888	0.29
40_K	44_R	0.887	0.29
28_K	79_D	0.882	0.29
23_N	42_K	0.868	0.28
24_Y	49_V	0.862	0.28
36_D	40_K	0.801	0.25
37_V	40_K	0.799	0.25
44_R	60_E	0.797	0.25
42_K	45_D	0.791	0.25
28_K	50_K	0.789	0.25
41_E	62_G	0.758	0.24
7_I	79_D	0.751	0.23
46_I	53_V	0.743	0.23
23_N	34_N	0.742	0.23
7_I	34_N	0.741	0.23
43_L	53_V	0.738	0.23
38_S	41_E	0.723	0.22
12_K	18_C	0.713	0.22
20_E	26_N	0.710	0.22
23_N	76_E	0.704	0.21
43_L	77_H	0.704	0.21
31_P	49_V	0.697	0.21
25_L	62_G	0.696	0.21
14_G	43_L	0.689	0.21
25_L	64_G	0.688	0.21
62_G	80_L	0.686	0.21
3_D	8_V	0.676	0.20
33_Q	41_E	0.670	0.20
58_V	65_N	0.666	0.20
26_N	46_I	0.662	0.20
29_G	61_I	0.656	0.20
23_N	26_N	0.647	0.19
10_W	63_R	0.638	0.19
33_Q	61_I	0.636	0.19
22_K	37_V	0.628	0.19
19_E	49_V	0.620	0.18
24_Y	60_E	0.615	0.18
4_V	48_Q	0.613	0.18
40_K	60_E	0.609	0.18
3_D	76_E	0.607	0.18
43_L	60_E	0.601	0.18
42_K	59_V	0.595	0.18
16_S	53_V	0.594	0.18
17_Y	70_I	0.591	0.17
10_W	44_R	0.588	0.17
35_I	77_H	0.583	0.17
39_E	75_I	0.581	0.17
26_N	49_V	0.580	0.17
35_I	75_I	0.578	0.17
28_K	64_G	0.573	0.17
13_K	53_V	0.571	0.17
51_Y	62_G	0.569	0.17
12_K	15_C	0.567	0.17
59_V	64_G	0.567	0.17
44_R	58_V	0.563	0.16
35_I	48_Q	0.562	0.16
16_S	65_N	0.552	0.16
12_K	17_Y	0.545	0.16
36_D	44_R	0.540	0.16
41_E	52_G	0.531	0.16
28_K	59_V	0.525	0.15
12_K	38_S	0.524	0.15
5_V	49_V	0.518	0.15
43_L	46_I	0.515	0.15
4_V	8_V	0.506	0.15
52_G	62_G	0.502	0.15
25_L	42_K	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jadA	1	0.9355	99.8	0.486	Contact Map
2wciA	3	0.9677	99.7	0.551	Contact Map
1u6tA	1	0.914	99.6	0.555	Contact Map
2wulA	3	0.9677	99.6	0.573	Contact Map
3gx8A	1	0.9677	99.6	0.576	Contact Map
3l4nA	1	0.9677	99.6	0.578	Contact Map
3zywA	1	0.9677	99.6	0.584	Contact Map
1wikA	1	0.9677	99.5	0.586	Contact Map
3ipzA	3	0.957	99.5	0.59	Contact Map
2ct6A	1	0.9677	99.5	0.593	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.