GUAD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GUAD - Guanine deaminase

UniProt:	O34598	Sequences: MNHETFLKRAVTLACEGVNAGIGGPFGAVIVKDGAIIAEGQNNVTTSNDPTAHAEVTAIRKACKVLGAYQLDDCILYTSCEPCPMCLGAIYWARPKAVFYAAEHTDAAEAGFDDSFIYKEIDKPAEERTIPFYQVTLTEHLSPFQAWRNFANKKEY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (144)
Sequences:	6155 (4241)
Seq/√Len:	353.4

ECOLI - TADA RIBD
BACSU - GUAD TADA COMEB RIBD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_R	39_E	3.457	1.00
9_R	12_T	2.629	1.00
49_D	60_R	2.618	1.00
73_D	96_K	2.613	1.00
75_I	99_F	2.449	1.00
100_Y	103_E	2.420	1.00
75_I	97_A	2.412	1.00
43_N	47_S	2.401	1.00
13_L	39_E	2.256	1.00
13_L	16_E	2.096	1.00
8_K	132_F	2.078	1.00
9_R	36_I	2.040	1.00
43_N	57_T	2.034	1.00
6_F	31_V	2.034	1.00
76_L	90_I	2.003	1.00
30_I	58_A	1.974	1.00
103_E	129_T	1.944	1.00
137_L	141_L	1.893	1.00
97_A	126_E	1.885	1.00
75_I	96_K	1.773	1.00
32_K	35_A	1.733	1.00
90_I	98_V	1.733	1.00
13_L	41_Q	1.714	1.00
6_F	36_I	1.678	1.00
101_A	136_T	1.673	1.00
32_K	74_C	1.663	1.00
138_T	142_S	1.639	1.00
115_S	118_Y	1.637	1.00
132_F	135_V	1.626	1.00
97_A	128_R	1.616	1.00
18_V	146_A	1.596	1.00
45_T	69_Y	1.511	1.00
31_V	77_Y	1.509	1.00
16_E	41_Q	1.493	1.00
40_G	57_T	1.460	1.00
80_C	140_H	1.453	1.00
38_A	61_K	1.425	1.00
20_A	41_Q	1.376	1.00
15_C	139_E	1.347	1.00
38_A	65_V	1.340	1.00
50_P	63_C	1.338	1.00
30_I	62_A	1.338	1.00
133_Y	137_L	1.307	1.00
9_R	13_L	1.295	1.00
44_V	69_Y	1.274	1.00
8_K	135_V	1.249	1.00
43_N	46_T	1.249	1.00
56_V	89_A	1.245	1.00
111_G	115_S	1.243	1.00
100_Y	129_T	1.231	1.00
136_T	139_E	1.218	1.00
142_S	145_Q	1.217	1.00
17_G	41_Q	1.198	1.00
5_T	9_R	1.185	1.00
51_T	89_A	1.177	1.00
26_F	80_C	1.176	1.00
37_I	74_C	1.170	1.00
32_K	37_I	1.169	1.00
38_A	58_A	1.156	1.00
32_K	73_D	1.154	1.00
30_I	74_C	1.142	1.00
114_D	119_K	1.135	1.00
61_K	65_V	1.098	1.00
12_T	15_C	1.095	1.00
134_Q	138_T	1.094	1.00
15_C	18_V	1.079	1.00
61_K	64_K	1.070	1.00
142_S	146_A	1.066	1.00
52_A	57_T	1.046	1.00
20_A	46_T	1.035	1.00
28_A	76_L	1.027	1.00
40_G	58_A	1.024	1.00
59_I	63_C	1.020	1.00
11_V	15_C	1.009	1.00
47_S	57_T	1.007	1.00
76_L	95_P	1.001	1.00
15_C	19_N	0.999	1.00
10_A	27_G	0.992	1.00
20_A	23_G	0.986	1.00
11_V	139_E	0.978	1.00
57_T	61_K	0.977	1.00
35_A	65_V	0.976	1.00
52_A	60_R	0.954	1.00
91_Y	117_I	0.945	1.00
102_A	144_F	0.942	1.00
102_A	137_L	0.917	1.00
21_G	147_W	0.917	1.00
33_D	73_D	0.913	1.00
138_T	141_L	0.908	1.00
30_I	38_A	0.905	1.00
10_A	79_S	0.900	1.00
84_P	116_F	0.890	1.00
130_I	133_Y	0.889	1.00
4_E	8_K	0.888	1.00
32_K	66_L	0.885	1.00
11_V	136_T	0.880	1.00
80_C	102_A	0.875	1.00
40_G	61_K	0.875	1.00
113_D	119_K	0.869	1.00
100_Y	111_G	0.865	1.00
44_V	92_W	0.862	1.00
5_T	8_K	0.860	1.00
16_E	19_N	0.858	1.00
36_I	39_E	0.854	1.00
115_S	119_K	0.853	1.00
16_E	20_A	0.847	1.00
49_D	52_A	0.833	1.00
51_T	56_V	0.824	1.00
98_V	110_A	0.821	1.00
110_A	117_I	0.821	1.00
47_S	52_A	0.815	1.00
59_I	93_A	0.813	1.00
88_G	116_F	0.812	1.00
43_N	61_K	0.810	1.00
98_V	125_A	0.800	1.00
8_K	12_T	0.797	1.00
43_N	52_A	0.786	1.00
6_F	77_Y	0.785	1.00
88_G	92_W	0.779	1.00
59_I	90_I	0.777	1.00
7_L	10_A	0.773	1.00
56_V	60_R	0.757	1.00
129_T	133_Y	0.755	1.00
59_I	71_L	0.753	1.00
47_S	64_K	0.752	1.00
12_T	16_E	0.742	1.00
15_C	135_V	0.733	1.00
135_V	139_E	0.729	0.99
117_I	125_A	0.720	0.99
91_Y	122_D	0.719	0.99
8_K	136_T	0.715	0.99
109_E	114_D	0.703	0.99
141_L	145_Q	0.703	0.99
63_C	71_L	0.699	0.99
44_V	51_T	0.699	0.99
87_L	117_I	0.698	0.99
70_Q	94_R	0.697	0.99
51_T	60_R	0.693	0.99
15_C	142_S	0.693	0.99
99_F	131_P	0.692	0.99
87_L	91_Y	0.689	0.99
103_E	111_G	0.687	0.99
37_I	65_V	0.686	0.99
41_Q	46_T	0.685	0.99
84_P	114_D	0.684	0.99
59_I	89_A	0.679	0.99
109_E	121_I	0.676	0.99
72_D	96_K	0.675	0.99
30_I	59_I	0.674	0.99
6_F	9_R	0.673	0.99
66_L	74_C	0.670	0.99
98_V	117_I	0.670	0.99
103_E	133_Y	0.658	0.99
48_N	67_G	0.654	0.99
108_A	112_F	0.653	0.99
128_R	131_P	0.652	0.99
48_N	68_A	0.650	0.99
114_D	117_I	0.647	0.99
99_F	128_R	0.647	0.99
84_P	104_H	0.643	0.99
104_H	107_A	0.641	0.99
4_E	132_F	0.641	0.99
10_A	29_V	0.641	0.99
31_V	36_I	0.639	0.99
109_E	116_F	0.630	0.99
14_A	102_A	0.629	0.99
91_Y	121_I	0.629	0.99
77_Y	99_F	0.628	0.99
28_A	54_A	0.626	0.98
24_G	44_V	0.621	0.98
74_C	95_P	0.615	0.98
18_V	142_S	0.615	0.98
87_L	109_E	0.613	0.98
91_Y	125_A	0.611	0.98
68_A	72_D	0.610	0.98
139_E	142_S	0.610	0.98
29_V	36_I	0.607	0.98
134_Q	137_L	0.606	0.98
29_V	39_E	0.606	0.98
84_P	119_K	0.605	0.98
7_L	130_I	0.600	0.98
45_T	68_A	0.591	0.98
39_E	61_K	0.590	0.98
17_G	23_G	0.590	0.98
94_R	123_K	0.577	0.97
14_A	143_P	0.571	0.97
109_E	112_F	0.569	0.97
80_C	104_H	0.566	0.97
114_D	121_I	0.562	0.97
23_G	46_T	0.561	0.97
78_T	98_V	0.557	0.97
54_A	78_T	0.556	0.97
143_P	147_W	0.556	0.97
62_A	71_L	0.553	0.97
7_L	101_A	0.544	0.96
90_I	125_A	0.541	0.96
110_A	113_D	0.539	0.96
84_P	87_L	0.537	0.96
139_E	143_P	0.536	0.96
135_V	138_T	0.536	0.96
13_L	29_V	0.535	0.96
138_T	145_Q	0.532	0.96
116_F	119_K	0.531	0.96
37_I	66_L	0.531	0.96
76_L	98_V	0.521	0.95
84_P	107_A	0.519	0.95
76_L	100_Y	0.519	0.95
127_E	130_I	0.519	0.95
27_G	79_S	0.519	0.95
56_V	85_M	0.516	0.95
27_G	41_Q	0.513	0.95
140_H	143_P	0.510	0.95
48_N	69_Y	0.503	0.94
114_D	118_Y	0.502	0.94
131_P	136_T	0.501	0.94
133_Y	136_T	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1z3aA	2	0.9679	100	0.197	Contact Map
2nx8A	2	0.9936	100	0.205	Contact Map
2b3jA	2	0.9615	100	0.206	Contact Map
1wwrA	3	0.9615	100	0.224	Contact Map
3dh1A	2	0.9295	100	0.228	Contact Map
2a8nA	2	0.891	100	0.245	Contact Map
1wkqA	2	0.9679	100	0.252	Contact Map
2g84A	2	0.9872	100	0.258	Contact Map
1p6oA	2	0.9103	100	0.321	Contact Map
2b3zA	3	0.9038	100	0.327	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.