YJQA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJQA - Uncharacterized protein YjqA

UniProt:	O34593	Sequences: MGFIDGLLGNASTLSTAAVQEELAHILLEGEKVEAAFKLVRDLIVFTDKRLILVDKQGITGKKTEFQSIPYKSISRFSVETAGRFDLDSELKIWISGAELPAVSKQFKKDESIYDIQKVLAAVCM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	125 (114)
Sequences:	602 (393)
Seq/√Len:	36.8

BACSU - YJQA YOZO

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_Q	76_R	5.867	1.00
29_E	122_A	2.688	1.00
92_K	104_S	2.546	1.00
41_R	57_Q	2.526	1.00
79_V	91_L	2.516	1.00
46_F	71_Y	2.515	1.00
23_L	26_I	2.440	1.00
75_S	96_S	2.421	1.00
19_V	36_A	2.411	1.00
41_R	58_G	2.253	0.99
43_L	54_V	2.207	0.99
108_K	111_E	2.160	0.99
69_I	103_V	2.134	0.99
79_V	117_Q	2.004	0.99
117_Q	121_A	1.890	0.98
53_L	105_K	1.836	0.97
18_A	21_E	1.829	0.97
29_E	118_K	1.812	0.97
22_E	56_K	1.759	0.97
65_E	78_S	1.732	0.96
18_A	38_K	1.668	0.95
14_L	19_V	1.649	0.95
32_K	48_D	1.638	0.95
44_I	53_L	1.523	0.93
44_I	105_K	1.496	0.92
57_Q	61_G	1.495	0.92
23_L	45_V	1.495	0.92
76_R	98_A	1.453	0.91
12_S	88_D	1.414	0.89
58_G	61_G	1.385	0.88
51_L	105_K	1.363	0.88
65_E	92_K	1.356	0.87
16_T	33_V	1.338	0.87
19_V	33_V	1.292	0.85
34_E	48_D	1.278	0.84
44_I	49_K	1.272	0.84
62_K	93_I	1.246	0.82
63_K	80_E	1.243	0.82
15_S	32_K	1.230	0.82
77_F	121_A	1.220	0.81
16_T	122_A	1.219	0.81
15_S	18_A	1.189	0.79
41_R	60_T	1.175	0.78
29_E	48_D	1.174	0.78
62_K	81_T	1.157	0.77
110_D	115_D	1.135	0.76
24_A	112_S	1.120	0.75
67_Q	98_A	1.119	0.75
70_P	86_D	1.117	0.75
23_L	119_V	1.114	0.75
25_H	112_S	1.104	0.74
6_G	40_V	1.084	0.73
88_D	106_Q	1.069	0.72
82_A	109_K	1.063	0.71
71_Y	77_F	1.053	0.70
46_F	68_S	1.046	0.70
55_D	65_E	1.038	0.69
60_T	84_R	1.031	0.69
89_S	92_K	1.030	0.69
24_A	33_V	1.015	0.67
63_K	86_D	0.998	0.66
41_R	61_G	0.985	0.65
51_L	74_I	0.973	0.64
107_F	115_D	0.962	0.63
112_S	115_D	0.912	0.59
56_K	64_T	0.899	0.58
7_L	55_D	0.878	0.56
18_A	30_G	0.875	0.56
28_L	121_A	0.874	0.56
8_L	29_E	0.849	0.54
117_Q	120_L	0.846	0.53
15_S	24_A	0.841	0.53
10_N	88_D	0.835	0.52
84_R	87_L	0.827	0.52
30_G	122_A	0.824	0.51
90_E	116_I	0.811	0.50
38_K	45_V	0.791	0.49
105_K	109_K	0.790	0.48
11_A	73_S	0.780	0.48
29_E	89_S	0.778	0.47
13_T	37_F	0.777	0.47
91_L	113_I	0.775	0.47
43_L	84_R	0.767	0.46
114_Y	117_Q	0.766	0.46
25_H	114_Y	0.764	0.46
16_T	22_E	0.761	0.46
36_A	70_P	0.749	0.45
49_K	109_K	0.736	0.44
68_S	80_E	0.733	0.43
53_L	69_I	0.732	0.43
82_A	114_Y	0.727	0.43
75_S	116_I	0.721	0.42
39_L	44_I	0.719	0.42
69_I	82_A	0.713	0.42
91_L	107_F	0.706	0.41
43_L	56_K	0.702	0.41
45_V	115_D	0.702	0.41
50_R	68_S	0.699	0.41
15_S	38_K	0.686	0.39
19_V	115_D	0.678	0.39
37_F	115_D	0.671	0.38
77_F	94_W	0.670	0.38
35_A	119_V	0.669	0.38
27_L	33_V	0.654	0.37
94_W	121_A	0.650	0.36
79_V	114_Y	0.650	0.36
51_L	121_A	0.649	0.36
45_V	49_K	0.647	0.36
73_S	95_I	0.646	0.36
59_I	85_F	0.644	0.36
48_D	122_A	0.643	0.36
95_I	117_Q	0.642	0.36
35_A	116_I	0.641	0.36
107_F	116_I	0.634	0.35
35_A	115_D	0.631	0.35
37_F	40_V	0.628	0.35
106_Q	111_E	0.626	0.35
57_Q	63_K	0.625	0.34
7_L	85_F	0.620	0.34
21_E	109_K	0.620	0.34
16_T	30_G	0.619	0.34
65_E	103_V	0.613	0.34
16_T	32_K	0.612	0.33
51_L	91_L	0.611	0.33
65_E	97_G	0.610	0.33
11_A	120_L	0.610	0.33
62_K	84_R	0.609	0.33
44_I	76_R	0.603	0.33
8_L	56_K	0.603	0.33
59_I	109_K	0.601	0.33
13_T	35_A	0.597	0.32
91_L	105_K	0.594	0.32
58_G	90_E	0.591	0.32
38_K	72_K	0.589	0.32
6_G	82_A	0.589	0.32
9_G	39_L	0.588	0.32
28_L	78_S	0.581	0.31
35_A	82_A	0.579	0.31
73_S	121_A	0.579	0.31
22_E	51_L	0.576	0.31
20_Q	110_D	0.573	0.30
107_F	114_Y	0.572	0.30
52_I	60_T	0.571	0.30
33_V	36_A	0.561	0.30
61_G	81_T	0.561	0.30
59_I	116_I	0.558	0.29
108_K	119_V	0.557	0.29
68_S	71_Y	0.553	0.29
18_A	24_A	0.551	0.29
25_H	118_K	0.551	0.29
46_F	116_I	0.549	0.29
39_L	120_L	0.547	0.29
39_L	67_Q	0.545	0.28
6_G	12_S	0.534	0.28
69_I	95_I	0.531	0.27
26_I	107_F	0.530	0.27
22_E	93_I	0.528	0.27
35_A	79_V	0.526	0.27
46_F	91_L	0.526	0.27
25_H	113_I	0.523	0.27
95_I	107_F	0.521	0.27
45_V	106_Q	0.521	0.27
11_A	101_P	0.520	0.27
89_S	114_Y	0.520	0.27
41_R	90_E	0.519	0.27
81_T	117_Q	0.516	0.26
113_I	119_V	0.515	0.26
96_S	101_P	0.513	0.26
107_F	113_I	0.503	0.26
19_V	43_L	0.501	0.25
36_A	45_V	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3hsaA	3	0.904	100	0.111	Contact Map
3b77A	4	0.928	100	0.314	Contact Map
2cayA	4	0.88	95.8	0.874	Contact Map
1zsqA	1	0.776	92.8	0.891	Contact Map
1lw3A	1	0.776	91.3	0.896	Contact Map
2hthB	1	0.808	91.1	0.896	Contact Map
1w7pD	1	0	70.3	0.918	Contact Map
2yf0A	2	0.712	65.6	0.921	Contact Map
4r8gE	1	0.856	38.4	0.933	Contact Map
2i1jA	3	0.896	31.4	0.936	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.