FLAW - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FLAW - Probable flavodoxin-2

UniProt:	O34589	Sequences: MAKILLVYATMSGNTEAMADLIEKGLQEALAEVDRFEAMDIDDAQLFTDYDHVIMGTYTWGDGDLPDEFLDLVEDMEEIDFSGKTCAVFGSGDTAYEFFCGAVDTLEAKIKERGGDIVLPSVKIENNPEGEEEEELINFGRQFAKKSGCAV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (141)
Sequences:	4602 (3078)
Seq/√Len:	259.2

ECOLI - YQCA MIOC CYSJ FLAV FLAW
BACSU - FLAW FLAV CYSJ CYPD CYPE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
107_E	117_I	3.813	1.00
90_G	103_V	3.611	1.00
104_D	123_K	3.298	1.00
85_T	116_D	2.761	1.00
11_M	67_D	2.708	1.00
111_K	117_I	2.686	1.00
101_G	105_T	2.392	1.00
109_K	112_E	2.383	1.00
109_K	113_R	2.327	1.00
86_C	107_E	2.138	1.00
23_E	35_R	2.117	1.00
89_F	124_I	2.030	1.00
86_C	111_K	1.901	1.00
65_L	102_A	1.898	1.00
4_I	26_L	1.878	1.00
41_I	50_Y	1.819	1.00
26_L	144_A	1.807	1.00
88_V	103_V	1.730	1.00
6_L	23_E	1.724	1.00
52_H	85_T	1.706	1.00
9_A	69_F	1.666	1.00
7_V	38_A	1.661	1.00
77_E	109_K	1.661	1.00
86_C	117_I	1.650	1.00
15_T	56_G	1.620	1.00
16_E	20_D	1.608	1.00
23_E	33_V	1.560	1.00
38_A	72_L	1.557	1.00
107_E	121_S	1.534	1.00
107_E	111_K	1.483	1.00
55_M	110_I	1.474	1.00
7_V	41_I	1.456	1.00
119_L	142_Q	1.443	1.00
86_C	115_G	1.439	1.00
3_K	32_E	1.430	1.00
57_T	106_L	1.416	1.00
55_M	106_L	1.400	1.00
61_G	64_D	1.384	1.00
10_T	68_E	1.361	1.00
73_V	106_L	1.341	1.00
73_V	105_T	1.332	1.00
18_M	91_S	1.319	1.00
23_E	27_Q	1.313	1.00
18_M	136_L	1.310	1.00
9_A	57_T	1.282	1.00
20_D	35_R	1.273	1.00
110_I	115_G	1.268	1.00
54_I	87_A	1.243	1.00
72_L	106_L	1.241	1.00
56_G	89_F	1.237	1.00
54_I	143_F	1.236	1.00
53_V	84_K	1.230	1.00
104_D	121_S	1.220	1.00
5_L	36_F	1.190	1.00
135_E	139_F	1.169	1.00
34_D	50_Y	1.162	1.00
9_A	68_E	1.101	1.00
15_T	91_S	1.095	1.00
87_A	119_L	1.090	1.00
38_A	69_F	1.089	1.00
22_I	56_G	1.088	1.00
37_E	40_D	1.078	1.00
25_G	140_G	1.067	1.00
117_I	120_P	1.063	1.00
89_F	136_L	1.049	1.00
101_G	104_D	1.038	1.00
141_R	145_K	1.038	1.00
90_G	100_C	1.026	1.00
73_V	109_K	1.026	1.00
142_Q	145_K	1.004	1.00
62_D	98_F	1.001	1.00
57_T	102_A	0.996	1.00
108_A	112_E	0.991	1.00
100_C	123_K	0.976	1.00
119_L	143_F	0.975	1.00
25_G	137_I	0.975	1.00
58_Y	66_P	0.971	1.00
37_E	68_E	0.969	1.00
89_F	122_V	0.967	1.00
100_C	103_V	0.962	1.00
87_A	143_F	0.962	1.00
42_D	45_Q	0.953	1.00
26_L	33_V	0.953	1.00
25_G	141_R	0.938	1.00
4_I	31_A	0.907	1.00
65_L	69_F	0.906	1.00
6_L	33_V	0.881	1.00
59_T	100_C	0.881	1.00
9_A	66_P	0.879	1.00
7_V	53_V	0.878	1.00
75_D	79_I	0.877	1.00
83_G	116_D	0.876	1.00
17_A	21_L	0.873	1.00
73_V	102_A	0.872	1.00
57_T	69_F	0.869	1.00
22_I	140_G	0.869	1.00
5_L	50_Y	0.849	0.99
138_N	141_R	0.847	0.99
65_L	73_V	0.837	0.99
42_D	46_L	0.827	0.99
41_I	75_D	0.826	0.99
25_G	29_A	0.824	0.99
10_T	15_T	0.824	0.99
124_I	131_E	0.820	0.99
36_F	40_D	0.815	0.99
87_A	118_V	0.814	0.99
8_Y	16_E	0.813	0.99
67_D	70_L	0.812	0.99
124_I	136_L	0.807	0.99
81_F	115_G	0.793	0.99
124_I	128_P	0.787	0.99
65_L	105_T	0.786	0.99
86_C	110_I	0.776	0.99
138_N	142_Q	0.776	0.99
88_V	107_E	0.774	0.99
50_Y	53_V	0.771	0.99
18_M	56_G	0.771	0.99
39_M	68_E	0.771	0.99
57_T	66_P	0.769	0.99
5_L	34_D	0.768	0.99
3_K	51_D	0.767	0.99
12_S	62_D	0.765	0.99
64_D	105_T	0.762	0.99
103_V	121_S	0.752	0.99
25_G	144_A	0.751	0.99
108_A	111_K	0.749	0.99
4_I	52_H	0.749	0.99
22_I	54_I	0.744	0.99
4_I	54_I	0.744	0.99
73_V	77_E	0.742	0.99
3_K	34_D	0.732	0.98
27_Q	33_V	0.728	0.98
57_T	103_V	0.723	0.98
117_I	121_S	0.719	0.98
120_P	142_Q	0.711	0.98
9_A	38_A	0.711	0.98
8_Y	35_R	0.709	0.98
127_N	132_E	0.706	0.98
7_V	36_F	0.702	0.98
98_F	101_G	0.699	0.98
77_E	105_T	0.697	0.98
31_A	52_H	0.696	0.98
21_L	137_I	0.693	0.98
119_L	122_V	0.693	0.98
119_L	146_K	0.690	0.98
124_I	132_E	0.690	0.98
11_M	15_T	0.686	0.98
29_A	144_A	0.680	0.98
136_L	139_F	0.679	0.97
24_K	27_Q	0.678	0.97
17_A	20_D	0.668	0.97
5_L	51_D	0.660	0.97
62_D	97_E	0.660	0.97
92_G	96_Y	0.657	0.97
36_F	41_I	0.651	0.97
137_I	141_R	0.645	0.97
128_P	132_E	0.644	0.97
44_A	48_T	0.644	0.97
59_T	103_V	0.642	0.96
122_V	131_E	0.638	0.96
92_G	100_C	0.638	0.96
16_E	68_E	0.637	0.96
74_E	78_E	0.621	0.96
80_D	113_R	0.618	0.96
126_N	131_E	0.606	0.95
63_G	66_P	0.604	0.95
91_S	126_N	0.602	0.95
44_A	75_D	0.593	0.95
24_K	29_A	0.592	0.95
142_Q	146_K	0.590	0.94
46_L	49_D	0.584	0.94
55_M	66_P	0.579	0.94
7_V	55_M	0.578	0.94
92_G	99_F	0.577	0.94
45_Q	80_D	0.577	0.94
79_I	113_R	0.576	0.94
61_G	91_S	0.570	0.93
9_A	102_A	0.564	0.93
45_Q	79_I	0.564	0.93
14_N	17_A	0.560	0.93
93_D	127_N	0.559	0.93
85_T	118_V	0.559	0.93
110_I	117_I	0.555	0.92
32_E	111_K	0.550	0.92
33_V	36_F	0.548	0.92
3_K	50_Y	0.547	0.92
99_F	121_S	0.547	0.92
22_I	90_G	0.545	0.92
94_T	125_E	0.544	0.92
105_T	108_A	0.543	0.92
94_T	127_N	0.543	0.92
84_K	110_I	0.543	0.92
54_I	118_V	0.543	0.92
15_T	58_Y	0.538	0.91
60_W	126_N	0.538	0.91
6_L	26_L	0.534	0.91
76_M	113_R	0.533	0.91
6_L	35_R	0.527	0.90
24_K	28_E	0.526	0.90
103_V	123_K	0.526	0.90
41_I	72_L	0.518	0.90
14_N	58_Y	0.517	0.90
100_C	104_D	0.516	0.89
77_E	108_A	0.514	0.89
29_A	141_R	0.510	0.89
94_T	100_C	0.509	0.89
14_N	18_M	0.505	0.88
127_N	130_G	0.505	0.88
93_D	96_Y	0.504	0.88
39_M	71_D	0.503	0.88
19_A	35_R	0.502	0.88
65_L	106_L	0.500	0.88

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1tllA	2	0.9735	100	0.149	Contact Map
2bpoA	1	0.9868	100	0.199	Contact Map
3qe2A	1	0.9801	100	0.205	Contact Map
3hr4A	2	0.9735	100	0.272	Contact Map
1bvyF	1	0.9669	100	0.341	Contact Map
4h2dA	1	0.9868	100	0.35	Contact Map
1ykgA	1	0.947	100	0.375	Contact Map
4oxxA	1	0.9801	100	0.379	Contact Map
2m6rA	1	0.9603	100	0.383	Contact Map
2hnaA	1	0.9603	100	0.385	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.