YJZC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJZC - Uncharacterized protein YjzC

UniProt:	O34585	Sequences: MGQQHQFRPGQKAPNNGVYVEIGETGSMVKNPQKVHLSAGEMFPETSNHNRLWTYKRKP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	59 (57)
Sequences:	114 (63)
Seq/√Len:	8.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_E	50_N	3.143	0.91
9_P	46_T	2.847	0.86
20_V	28_M	2.314	0.71
34_K	56_K	2.309	0.71
20_V	56_K	2.183	0.67
4_Q	11_Q	1.944	0.57
26_G	29_V	1.915	0.56
33_Q	37_L	1.883	0.55
6_Q	52_L	1.803	0.51
3_Q	20_V	1.663	0.46
5_H	55_Y	1.558	0.41
9_P	52_L	1.331	0.32
3_Q	6_Q	1.306	0.31
42_M	45_E	1.294	0.31
9_P	38_S	1.292	0.31
1_M	24_E	1.277	0.30
35_V	52_L	1.273	0.30
33_Q	47_S	1.250	0.29
22_I	30_K	1.237	0.29
4_Q	35_V	1.196	0.28
20_V	42_M	1.180	0.27
30_K	52_L	1.122	0.25
3_Q	55_Y	1.099	0.25
9_P	42_M	1.085	0.24
37_L	41_E	1.079	0.24
34_K	52_L	1.042	0.23
36_H	46_T	1.031	0.22
31_N	45_E	1.019	0.22
37_L	47_S	1.001	0.22
41_E	52_L	0.996	0.21
30_K	47_S	0.993	0.21
12_K	41_E	0.987	0.21
36_H	47_S	0.967	0.21
25_T	29_V	0.963	0.21
29_V	39_A	0.957	0.20
27_S	46_T	0.945	0.20
16_N	57_R	0.939	0.20
18_V	36_H	0.928	0.20
28_M	57_R	0.909	0.19
16_N	26_G	0.901	0.19
3_Q	57_R	0.895	0.19
13_A	49_H	0.892	0.19
8_R	52_L	0.854	0.18
13_A	55_Y	0.850	0.18
25_T	36_H	0.844	0.17
45_E	57_R	0.837	0.17
31_N	42_M	0.835	0.17
5_H	20_V	0.832	0.17
47_S	56_K	0.797	0.16
38_S	45_E	0.789	0.16
18_V	45_E	0.789	0.16
28_M	54_T	0.788	0.16
41_E	56_K	0.784	0.16
11_Q	25_T	0.778	0.16
24_E	39_A	0.727	0.15
20_V	38_S	0.727	0.15
4_Q	8_R	0.720	0.15
33_Q	45_E	0.707	0.14
26_G	39_A	0.707	0.14
7_F	35_V	0.702	0.14
30_K	38_S	0.693	0.14
25_T	49_H	0.690	0.14
11_Q	36_H	0.670	0.14
13_A	45_E	0.650	0.13
6_Q	26_G	0.631	0.13
22_I	26_G	0.615	0.13
12_K	16_N	0.611	0.13
18_V	39_A	0.599	0.12
36_H	45_E	0.583	0.12
8_R	47_S	0.582	0.12
18_V	38_S	0.578	0.12
33_Q	49_H	0.576	0.12
6_Q	54_T	0.563	0.12
9_P	45_E	0.559	0.12
20_V	35_V	0.554	0.11
13_A	17_G	0.550	0.11
4_Q	12_K	0.550	0.11
35_V	46_T	0.547	0.11
12_K	48_N	0.539	0.11
31_N	49_H	0.537	0.11
27_S	30_K	0.534	0.11
18_V	34_K	0.533	0.11
11_Q	49_H	0.519	0.11
8_R	50_N	0.518	0.11
18_V	57_R	0.504	0.11
10_G	41_E	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4o5jA	1	0.4068	8.2	0.919	Contact Map
1bypA	1	0.7119	4.6	0.928	Contact Map
4umwA	1	0.8814	3.2	0.933	Contact Map
1m0dA	2	0.9322	3	0.934	Contact Map
4bbjA	1	0.8814	2.9	0.935	Contact Map
1hn0A	1	0.9661	2.9	0.935	Contact Map
4dp9X	1	0.7119	2.9	0.935	Contact Map
3t9gA	3	0.5424	2.8	0.935	Contact Map
3j08A	2	0.8814	2.6	0.936	Contact Map
4quvA	2	0.7288	2.4	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.