YOAA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOAA - Uncharacterized N-acetyltransferase YoaA

UniProt:	O34569	Sequences: MFPILETDRLILRQITDQDAEAIFACFSNDEVTRYYGLENMESIEQAISMIQTFAALYQEKRGIRWGIERRDTKELIGTIGFHALAQKHRRAEIGYEIIPEHWRNGFASEVISKVVSYGFSALGLSRIGAVVFTDNEASNRLLLKMGFQKEGVLRQYMYQNGTPYDTNVYSIVKPRE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	177 (165)
Sequences:	20301 (15577)
Seq/√Len:	1212.7

ECOLI - RIML RIMJ ATDA YHHY MNAT
BACSU - YOAA YDAF YJCK YOKL YNAD YJDG YKKB YWNH
HALSA - Q9HMZ2 Q9HNJ3 Q9HRY6 Q9HRY5 Q9HSL3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
109_S	145_K	2.627	1.00
130_A	143_L	2.600	1.00
13_R	69_E	2.587	1.00
70_R	73_T	2.429	1.00
13_R	19_D	2.293	1.00
31_E	100_P	2.270	1.00
6_E	71_R	2.176	1.00
92_A	125_L	2.163	1.00
132_V	140_N	2.159	1.00
151_E	171_S	2.155	1.00
150_K	153_V	2.105	1.00
150_K	168_N	2.098	1.00
9_R	110_E	2.090	1.00
82_F	119_G	2.056	1.00
7_T	114_K	1.997	1.00
140_N	144_L	1.897	1.00
132_V	143_L	1.890	1.00
94_I	112_I	1.884	1.00
141_R	144_L	1.871	1.00
117_S	121_S	1.807	1.00
116_V	148_F	1.804	1.00
15_I	67_G	1.798	1.00
67_G	76_L	1.792	1.00
7_T	110_E	1.749	1.00
29_N	100_P	1.727	1.00
11_I	71_R	1.677	1.00
20_A	48_I	1.642	1.00
153_V	168_N	1.633	1.00
22_A	76_L	1.633	1.00
99_I	102_H	1.631	1.00
116_V	128_I	1.629	1.00
126_S	156_Q	1.629	1.00
21_E	44_I	1.620	1.00
112_I	146_M	1.600	1.00
80_I	111_V	1.584	1.00
98_I	108_A	1.571	1.00
140_N	168_N	1.534	1.00
44_I	48_I	1.523	1.00
159_Y	164_P	1.505	1.00
69_E	74_K	1.505	1.00
50_M	54_F	1.487	1.00
114_K	117_S	1.463	1.00
134_T	166_D	1.459	1.00
43_S	46_Q	1.453	1.00
140_N	150_K	1.430	1.00
137_E	140_N	1.395	1.00
68_I	98_I	1.383	1.00
126_S	164_P	1.345	1.00
70_R	77_I	1.342	1.00
6_E	11_I	1.337	1.00
17_D	52_Q	1.324	1.00
144_L	150_K	1.312	1.00
80_I	115_V	1.284	1.00
68_I	111_V	1.271	1.00
118_Y	122_A	1.267	1.00
109_S	142_L	1.256	1.00
157_Y	167_T	1.246	1.00
134_T	153_V	1.237	1.00
135_D	165_Y	1.237	1.00
11_I	69_E	1.235	1.00
77_I	102_H	1.231	1.00
140_N	170_Y	1.222	1.00
154_L	169_V	1.189	1.00
22_A	75_E	1.189	1.00
70_R	107_F	1.187	1.00
24_F	44_I	1.185	1.00
96_Y	143_L	1.177	1.00
119_G	128_I	1.156	1.00
75_E	101_E	1.153	1.00
108_A	142_L	1.145	1.00
127_R	171_S	1.144	1.00
75_E	102_H	1.112	1.00
118_Y	123_L	1.111	1.00
20_A	51_I	1.099	1.00
79_T	97_E	1.088	1.00
7_T	10_L	1.082	1.00
86_A	89_H	1.081	1.00
48_I	52_Q	1.077	1.00
96_Y	139_S	1.066	1.00
66_W	115_V	1.064	1.00
32_V	103_W	1.051	1.00
119_G	123_L	1.048	1.00
26_C	99_I	1.042	1.00
26_C	97_E	1.038	1.00
109_S	113_S	1.034	1.00
100_P	103_W	1.026	1.00
103_W	138_A	1.023	1.00
20_A	44_I	1.016	1.00
155_R	171_S	1.005	1.00
91_R	129_G	1.004	1.00
156_Q	166_D	1.003	1.00
93_E	131_V	1.000	1.00
31_E	34_R	0.997	1.00
153_V	166_D	0.993	1.00
127_R	151_E	0.983	1.00
130_A	148_F	0.983	1.00
17_D	48_I	0.975	1.00
132_V	170_Y	0.968	1.00
22_A	25_A	0.968	1.00
70_R	75_E	0.963	1.00
10_L	107_F	0.961	1.00
150_K	170_Y	0.960	1.00
42_E	46_Q	0.959	1.00
142_L	146_M	0.959	1.00
56_A	60_E	0.952	1.00
15_I	79_T	0.941	1.00
109_S	146_M	0.940	1.00
66_W	118_Y	0.939	1.00
69_E	76_L	0.937	1.00
155_R	166_D	0.926	1.00
17_D	55_A	0.921	1.00
31_E	103_W	0.920	1.00
91_R	127_R	0.918	1.00
133_F	165_Y	0.910	1.00
137_E	141_R	0.905	1.00
104_R	138_A	0.897	1.00
143_L	148_F	0.894	1.00
119_G	125_L	0.891	1.00
82_F	115_V	0.886	1.00
116_V	146_M	0.877	1.00
113_S	117_S	0.869	1.00
70_R	105_N	0.868	1.00
49_S	53_T	0.867	1.00
134_T	168_N	0.867	1.00
22_A	99_I	0.856	1.00
11_I	74_K	0.854	1.00
25_A	99_I	0.852	1.00
98_I	107_F	0.851	1.00
113_S	146_M	0.847	1.00
20_A	24_F	0.829	1.00
70_R	102_H	0.818	1.00
19_D	69_E	0.816	1.00
102_H	105_N	0.812	1.00
10_L	111_V	0.811	1.00
90_R	164_P	0.809	1.00
17_D	20_A	0.809	1.00
75_E	99_I	0.803	1.00
68_I	80_I	0.802	1.00
96_Y	108_A	0.800	1.00
13_R	67_G	0.797	1.00
24_F	47_A	0.791	1.00
110_E	114_K	0.788	1.00
154_L	157_Y	0.783	1.00
41_M	47_A	0.778	1.00
27_F	97_E	0.764	1.00
91_R	157_Y	0.758	1.00
7_T	12_L	0.750	1.00
21_E	25_A	0.744	1.00
139_S	143_L	0.741	1.00
93_E	129_G	0.725	1.00
45_E	48_I	0.723	1.00
33_T	36_Y	0.722	1.00
65_R	81_G	0.720	1.00
52_Q	56_A	0.720	1.00
49_S	52_Q	0.720	1.00
25_A	75_E	0.719	1.00
35_Y	135_D	0.718	1.00
35_Y	133_F	0.717	1.00
54_F	65_R	0.715	1.00
159_Y	163_T	0.713	1.00
133_F	160_Q	0.713	1.00
151_E	155_R	0.708	1.00
137_E	144_L	0.702	1.00
90_R	159_Y	0.696	1.00
156_Q	164_P	0.688	1.00
24_F	28_S	0.687	1.00
96_Y	112_I	0.685	1.00
26_C	76_L	0.682	1.00
47_A	51_I	0.682	1.00
14_Q	58_Y	0.680	1.00
68_I	107_F	0.676	1.00
9_R	106_G	0.676	1.00
25_A	101_E	0.673	1.00
46_Q	49_S	0.672	1.00
53_T	56_A	0.671	1.00
131_V	167_T	0.670	1.00
45_E	49_S	0.666	1.00
112_I	142_L	0.666	1.00
131_V	154_L	0.665	1.00
104_R	109_S	0.663	1.00
29_N	99_I	0.657	1.00
8_D	110_E	0.650	1.00
68_I	78_G	0.646	1.00
104_R	141_R	0.645	1.00
33_T	38_L	0.643	1.00
77_I	107_F	0.643	1.00
98_I	103_W	0.641	1.00
14_Q	55_A	0.638	1.00
144_L	170_Y	0.638	1.00
141_R	145_K	0.634	1.00
29_N	103_W	0.630	1.00
138_A	141_R	0.625	1.00
135_D	163_T	0.617	1.00
96_Y	142_L	0.616	1.00
109_S	138_A	0.615	1.00
132_V	139_S	0.614	1.00
16_T	19_D	0.613	1.00
132_V	168_N	0.609	1.00
82_F	92_A	0.607	1.00
83_H	93_E	0.607	1.00
13_R	16_T	0.607	1.00
76_L	79_T	0.605	1.00
30_D	34_R	0.604	1.00
116_V	120_F	0.600	1.00
32_V	97_E	0.599	1.00
92_A	119_G	0.592	1.00
36_Y	97_E	0.590	1.00
42_E	47_A	0.590	1.00
152_G	171_S	0.588	1.00
129_G	154_L	0.584	1.00
129_G	157_Y	0.575	1.00
131_V	169_V	0.574	1.00
158_M	167_T	0.573	1.00
160_Q	163_T	0.573	1.00
98_I	102_H	0.572	1.00
90_R	126_S	0.572	1.00
107_F	110_E	0.572	1.00
80_I	112_I	0.567	1.00
68_I	108_A	0.562	1.00
84_A	92_A	0.558	1.00
130_A	139_S	0.555	1.00
63_G	81_G	0.553	1.00
55_A	58_Y	0.549	1.00
134_T	140_N	0.547	1.00
104_R	142_L	0.545	1.00
29_N	33_T	0.543	1.00
10_L	110_E	0.543	1.00
81_G	95_G	0.540	1.00
160_Q	165_Y	0.538	1.00
108_A	112_I	0.528	1.00
51_I	55_A	0.523	1.00
58_Y	64_I	0.518	1.00
22_A	26_C	0.517	1.00
12_L	114_K	0.516	1.00
94_I	128_I	0.516	1.00
130_A	170_Y	0.515	1.00
149_Q	155_R	0.514	1.00
51_I	54_F	0.512	1.00
23_I	79_T	0.510	1.00
112_I	116_V	0.510	1.00
21_E	24_F	0.509	1.00
85_L	92_A	0.504	1.00
19_D	22_A	0.504	1.00
22_A	69_E	0.504	1.00
131_V	157_Y	0.503	1.00
27_F	79_T	0.502	1.00
128_I	148_F	0.501	1.00
127_R	157_Y	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fckA	2	0.9661	100	0.297	Contact Map
3r9fA	1	0.9718	100	0.298	Contact Map
2vzyA	3	0.8927	100	0.309	Contact Map
3pzjA	2	0.9774	100	0.311	Contact Map
1yreA	2	0.9435	100	0.311	Contact Map
1nslA	3	0.9887	100	0.313	Contact Map
1s7kA	2	0.887	100	0.322	Contact Map
3fbuA	2	0.9435	100	0.328	Contact Map
3igrA	2	0.9944	100	0.336	Contact Map
2z10A	2	0.9661	100	0.336	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.