HIS5 - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIS5 - Imidazole glycerol phosphate synthase subunit HisH

UniProt:	O34565	Sequences: MIGVIDYGMGNLYSVSKALERVGVPYFVSEKPEELKEADAFILPGVGSFGDAMDNLGYTKLDQLIHDMVSEGRLLLGICLGMQLLFEESEENGTASGLGLLKGKAVRLKAEDEKGNKLKVPHMGWNRLSFHNESPLLTKTEQGYAYFVHSYYIDGMEENALLASADYGVRVPAVVGKRNVFGAQFHPEKSSTVGMSILTQFTKMAAEQKVKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	212 (197)
Sequences:	3889 (2552)
Seq/√Len:	181.8

ECOLI - HIS5
BACSU - HIS5
HALSA - HIS5
SULSO - HIS5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_G	29_S	3.255	1.00
87_E	99_G	3.106	1.00
57_G	62_D	3.013	1.00
88_E	104_K	2.816	1.00
165_A	173_A	2.796	1.00
27_F	34_E	2.709	1.00
134_S	176_G	2.573	1.00
199_T	203_K	2.529	1.00
106_V	154_D	2.435	1.00
31_K	34_E	2.330	1.00
19_L	42_I	2.226	1.00
108_L	171_V	2.065	1.00
3_G	38_A	2.061	1.00
36_K	67_D	1.983	1.00
166_D	170_R	1.965	1.00
87_E	102_K	1.964	1.00
86_F	153_I	1.938	1.00
68_M	73_R	1.935	1.00
164_S	170_R	1.915	1.00
49_F	97_G	1.905	1.00
137_L	174_V	1.890	1.00
128_L	145_A	1.806	1.00
54_D	58_Y	1.803	1.00
17_K	20_E	1.787	1.00
147_F	173_A	1.783	1.00
41_F	68_M	1.775	1.00
16_S	20_E	1.762	1.00
52_A	80_L	1.707	1.00
86_F	175_V	1.704	1.00
88_E	94_T	1.670	1.00
90_E	106_V	1.639	1.00
68_M	71_E	1.628	1.00
55_N	58_Y	1.613	1.00
139_K	200_Q	1.608	1.00
162_L	176_G	1.606	1.00
30_E	59_T	1.600	1.00
163_A	174_V	1.597	1.00
69_V	100_L	1.591	1.00
196_S	199_T	1.581	1.00
145_A	193_V	1.560	1.00
152_Y	169_V	1.548	1.00
105_A	153_I	1.547	1.00
2_I	202_T	1.528	1.00
136_L	181_F	1.518	1.00
24_V	202_T	1.510	1.00
161_L	172_P	1.509	1.00
66_H	100_L	1.501	1.00
118_L	168_G	1.483	1.00
4_V	16_S	1.478	1.00
174_V	183_A	1.462	1.00
160_A	177_K	1.436	1.00
19_L	24_V	1.414	1.00
145_A	197_I	1.392	1.00
90_E	104_K	1.387	1.00
108_L	152_Y	1.384	1.00
16_S	28_V	1.381	1.00
155_G	161_L	1.379	1.00
12_L	28_V	1.378	1.00
33_E	37_E	1.368	1.00
16_S	26_Y	1.364	1.00
85_L	180_V	1.364	1.00
62_D	66_H	1.352	1.00
106_V	152_Y	1.349	1.00
4_V	19_L	1.299	1.00
87_E	103_G	1.298	1.00
102_K	160_A	1.278	1.00
128_L	163_A	1.278	1.00
3_G	35_L	1.271	1.00
21_R	195_M	1.260	1.00
122_H	171_V	1.255	1.00
56_L	62_D	1.252	1.00
78_I	198_L	1.251	1.00
29_S	34_E	1.239	1.00
50_G	95_A	1.235	1.00
88_E	96_S	1.224	1.00
101_L	160_A	1.212	1.00
67_D	71_E	1.208	1.00
183_A	197_I	1.207	1.00
196_S	200_Q	1.206	1.00
138_T	203_K	1.203	1.00
20_E	25_P	1.196	1.00
82_M	182_G	1.193	1.00
135_P	176_G	1.192	1.00
35_L	64_L	1.170	1.00
131_H	164_S	1.148	1.00
55_N	59_T	1.136	1.00
109_K	169_V	1.134	1.00
3_G	41_F	1.113	1.00
64_L	68_M	1.103	1.00
129_S	170_R	1.096	1.00
85_L	100_L	1.095	1.00
33_E	36_K	1.074	1.00
139_K	196_S	1.073	1.00
86_F	105_A	1.070	1.00
90_E	94_T	1.060	1.00
29_S	38_A	1.060	1.00
20_E	26_Y	1.046	1.00
140_T	143_G	1.043	1.00
7_Y	10_G	1.042	1.00
157_E	160_A	1.033	1.00
23_G	26_Y	1.029	1.00
50_G	93_G	1.018	0.99
35_L	38_A	1.016	0.99
123_M	148_V	1.004	0.99
13_Y	17_K	1.003	0.99
36_K	68_M	1.002	0.99
32_P	36_K	0.987	0.99
166_D	169_V	0.987	0.99
87_E	104_K	0.985	0.99
140_T	200_Q	0.975	0.99
82_M	153_I	0.970	0.99
152_Y	172_P	0.970	0.99
128_L	173_A	0.970	0.99
50_G	92_N	0.968	0.99
86_F	101_L	0.963	0.99
19_L	26_Y	0.963	0.99
127_R	144_Y	0.962	0.99
86_F	103_G	0.953	0.99
134_S	181_F	0.949	0.99
69_V	75_L	0.942	0.99
43_L	75_L	0.937	0.99
136_L	200_Q	0.933	0.99
46_V	80_L	0.923	0.99
102_K	156_M	0.916	0.99
162_L	174_V	0.916	0.99
104_K	154_D	0.916	0.99
130_F	142_Q	0.915	0.99
165_A	171_V	0.909	0.99
90_E	107_R	0.901	0.99
176_G	181_F	0.895	0.99
76_L	183_A	0.890	0.99
4_V	26_Y	0.887	0.99
32_P	64_L	0.885	0.99
75_L	100_L	0.881	0.98
35_L	68_M	0.880	0.98
129_S	166_D	0.874	0.98
5_I	65_I	0.872	0.98
147_F	165_A	0.870	0.98
134_S	162_L	0.869	0.98
65_I	100_L	0.867	0.98
63_Q	66_H	0.867	0.98
53_M	62_D	0.864	0.98
127_R	143_G	0.861	0.98
19_L	202_T	0.860	0.98
29_S	61_L	0.854	0.98
63_Q	67_D	0.843	0.98
48_S	92_N	0.825	0.98
8_G	55_N	0.824	0.98
8_G	59_T	0.823	0.98
19_L	198_L	0.818	0.98
67_D	70_S	0.813	0.97
34_E	37_E	0.813	0.97
107_R	110_A	0.809	0.97
49_F	84_L	0.807	0.97
92_N	95_A	0.803	0.97
2_I	40_A	0.802	0.97
22_V	202_T	0.801	0.97
60_K	63_Q	0.801	0.97
118_L	167_Y	0.797	0.97
56_L	61_L	0.796	0.97
122_H	149_H	0.796	0.97
87_E	101_L	0.794	0.97
66_H	70_S	0.791	0.97
128_L	197_I	0.789	0.97
72_G	178_R	0.789	0.97
53_M	57_G	0.788	0.97
40_A	201_F	0.785	0.97
131_H	170_R	0.784	0.97
96_S	99_G	0.784	0.97
41_F	64_L	0.779	0.97
111_E	168_G	0.778	0.97
32_P	35_L	0.775	0.97
13_Y	16_S	0.770	0.96
75_L	85_L	0.770	0.96
5_I	43_L	0.749	0.96
52_A	84_L	0.748	0.96
163_A	173_A	0.744	0.96
108_L	120_V	0.740	0.96
129_S	143_G	0.740	0.96
57_G	96_S	0.738	0.96
46_V	82_M	0.737	0.95
53_M	95_A	0.736	0.95
129_S	142_Q	0.735	0.95
32_P	60_K	0.734	0.95
2_I	24_V	0.732	0.95
3_G	27_F	0.731	0.95
35_L	61_L	0.729	0.95
101_L	175_V	0.727	0.95
41_F	65_I	0.726	0.95
18_A	22_V	0.721	0.95
129_S	164_S	0.721	0.95
122_H	126_N	0.711	0.95
100_L	180_V	0.709	0.94
155_G	172_P	0.706	0.94
3_G	34_E	0.702	0.94
154_D	169_V	0.697	0.94
123_M	144_Y	0.695	0.94
6_D	30_E	0.693	0.94
9_M	13_Y	0.687	0.93
138_T	196_S	0.683	0.93
122_H	165_A	0.683	0.93
56_L	65_I	0.672	0.93
72_G	179_N	0.668	0.93
7_Y	52_A	0.666	0.92
50_G	54_D	0.666	0.92
19_L	22_V	0.659	0.92
49_F	95_A	0.658	0.92
141_E	193_V	0.657	0.92
50_G	94_T	0.649	0.91
80_L	84_L	0.648	0.91
75_L	180_V	0.648	0.91
130_F	163_A	0.643	0.91
4_V	28_V	0.642	0.91
133_E	138_T	0.640	0.91
29_S	64_L	0.640	0.91
175_V	182_G	0.639	0.91
102_K	157_E	0.636	0.91
40_A	74_L	0.635	0.91
48_S	95_A	0.635	0.91
9_M	12_L	0.631	0.90
32_P	63_Q	0.630	0.90
15_V	18_A	0.630	0.90
103_G	153_I	0.624	0.90
5_I	41_F	0.623	0.90
26_Y	42_I	0.618	0.89
22_V	195_M	0.617	0.89
5_I	35_L	0.616	0.89
101_L	180_V	0.616	0.89
102_K	177_K	0.609	0.89
15_V	78_I	0.609	0.89
40_A	191_S	0.605	0.88
110_A	118_L	0.603	0.88
162_L	181_F	0.601	0.88
144_Y	193_V	0.600	0.88
17_K	195_M	0.596	0.88
22_V	198_L	0.593	0.87
69_V	72_G	0.591	0.87
13_Y	171_V	0.589	0.87
29_S	35_L	0.587	0.87
140_T	145_A	0.586	0.87
132_N	159_N	0.583	0.86
135_P	138_T	0.582	0.86
132_N	162_L	0.568	0.85
128_L	171_V	0.565	0.85
54_D	57_G	0.565	0.85
89_S	108_L	0.564	0.85
9_M	52_A	0.563	0.84
126_N	167_Y	0.561	0.84
26_Y	80_L	0.559	0.84
48_S	51_D	0.557	0.84
65_I	68_M	0.546	0.83
56_L	59_T	0.544	0.82
76_L	201_F	0.540	0.82
90_E	109_K	0.539	0.82
87_E	156_M	0.539	0.82
136_L	197_I	0.536	0.81
40_A	181_F	0.535	0.81
53_M	90_E	0.533	0.81
52_A	55_N	0.532	0.81
104_K	156_M	0.531	0.81
15_V	80_L	0.531	0.81
154_D	158_E	0.531	0.81
121_P	150_S	0.530	0.81
162_L	182_G	0.529	0.81
88_E	95_A	0.526	0.80
107_R	151_Y	0.526	0.80
181_F	201_F	0.524	0.80
145_A	183_A	0.523	0.80
123_M	147_F	0.522	0.80
57_G	95_A	0.521	0.80
49_F	89_S	0.521	0.80
89_S	92_N	0.519	0.79
53_M	84_L	0.518	0.79
9_M	80_L	0.516	0.79
15_V	42_I	0.514	0.79
41_F	73_R	0.514	0.79
8_G	105_A	0.514	0.79
9_M	51_D	0.513	0.79
14_S	17_K	0.513	0.79
43_L	84_L	0.512	0.78
48_S	93_G	0.512	0.78
169_V	172_P	0.512	0.78
17_K	191_S	0.510	0.78
145_A	185_F	0.509	0.78
40_A	202_T	0.508	0.78
156_M	160_A	0.508	0.78
111_E	117_K	0.507	0.78
99_G	102_K	0.507	0.78
48_S	148_V	0.507	0.78
12_L	119_K	0.506	0.78
156_M	159_N	0.506	0.78
65_I	98_L	0.503	0.77
42_I	78_I	0.502	0.77
59_T	80_L	0.501	0.77
49_F	86_F	0.500	0.77
161_L	164_S	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jvnA	1	0.9623	100	0.442	Contact Map
4gudA	1	0.9292	100	0.497	Contact Map
1ka9H	1	0.9104	100	0.519	Contact Map
1gpwB	1	0.9104	100	0.53	Contact Map
3uowA	2	0.9151	100	0.547	Contact Map
2v4uA	1	0.9481	100	0.569	Contact Map
2ywdA	1	0.8774	100	0.585	Contact Map
2w7tA	1	0.9434	100	0.591	Contact Map
3d54D	1	0.8821	100	0.592	Contact Map
2issD	1	0.8396	100	0.593	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.