RPE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RPE - Ribulose-phosphate 3-epimerase

UniProt:	O34557	Sequences: MIKVAPSILSADFAALGNEIKDVEKGGADCIHIDVMDGHFVPNITIGPLIVEAVRPVTDLPLDVHLMIEEPDRYIPAFAKAGADILSVHAEACPHLHRTIQLIKEQGVKAGVVLNPHTPVQVIEHVFDDLDLVLLMTVNPGFGGQKFIHSVLPKIKEVKRMADEKGKKDLLIEVDGGVNKETAPLVIEAGANLLVAGSAVYGQSDRKKAISEIRGSK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	217 (211)
Sequences:	4314 (2604)
Seq/√Len:	179.3

ECOLI - SGCE RPE ALSE
BACSU - RPE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_A	18_N	3.287	1.00
162_A	170_L	3.285	1.00
183_A	194_L	2.739	1.00
171_L	192_N	2.521	1.00
178_V	186_V	2.341	1.00
24_E	60_L	2.242	1.00
159_K	163_D	2.235	1.00
64_V	83_A	2.218	1.00
39_H	69_E	2.194	1.00
86_L	108_V	2.173	1.00
121_Q	124_E	2.115	1.00
203_Q	209_A	2.060	1.00
133_V	158_V	2.056	1.00
76_P	102_L	2.049	1.00
147_F	152_L	2.043	1.00
149_H	185_L	2.022	1.00
87_S	113_V	2.005	1.00
70_E	73_R	1.988	1.00
97_H	129_D	1.921	1.00
205_D	208_K	1.898	1.00
33_I	51_V	1.880	1.00
111_G	132_L	1.846	1.00
124_E	157_E	1.799	1.00
79_A	108_V	1.773	1.00
22_D	206_R	1.760	1.00
184_P	188_E	1.749	1.00
135_L	151_V	1.737	1.00
72_D	93_C	1.727	1.00
117_H	139_N	1.710	1.00
160_R	164_E	1.703	1.00
90_A	122_V	1.692	1.00
61_P	85_I	1.691	1.00
153_P	156_K	1.690	1.00
76_P	106_Q	1.686	1.00
76_P	80_K	1.657	1.00
88_V	96_L	1.648	1.00
207_K	211_S	1.636	1.00
3_K	171_L	1.628	1.00
187_I	194_L	1.625	1.00
87_S	132_L	1.617	1.00
137_T	151_V	1.616	1.00
165_K	168_K	1.596	1.00
102_L	105_E	1.584	1.00
91_E	118_T	1.572	1.00
159_K	162_A	1.544	1.00
104_K	110_A	1.538	1.00
120_V	158_V	1.521	1.00
179_N	182_T	1.504	1.00
124_E	161_M	1.500	1.00
17_G	21_K	1.485	1.00
72_D	99_T	1.467	1.00
33_I	62_L	1.456	1.00
115_N	139_N	1.424	1.00
29_D	214_R	1.424	1.00
21_K	25_K	1.413	1.00
30_C	193_L	1.409	1.00
135_L	158_V	1.403	1.00
52_E	80_K	1.398	1.00
182_T	186_V	1.392	1.00
69_E	94_P	1.383	1.00
23_V	31_I	1.375	1.00
171_L	193_L	1.335	1.00
95_H	98_R	1.335	1.00
51_V	62_L	1.333	1.00
14_A	17_G	1.322	1.00
24_E	59_D	1.316	1.00
180_K	199_A	1.308	1.00
162_A	168_K	1.302	1.00
104_K	131_D	1.302	1.00
152_L	185_L	1.302	1.00
55_R	62_L	1.300	1.00
55_R	84_D	1.299	1.00
19_E	206_R	1.291	1.00
208_K	212_E	1.289	1.00
101_Q	105_E	1.285	1.00
39_H	70_E	1.284	1.00
5_A	193_L	1.275	1.00
19_E	22_D	1.247	1.00
85_I	109_K	1.245	1.00
14_A	57_V	1.242	1.00
96_L	112_V	1.230	1.00
112_V	130_L	1.223	1.00
5_A	30_C	1.218	1.00
162_A	192_N	1.201	1.00
20_I	54_V	1.198	1.00
120_V	125_H	1.195	1.00
101_Q	129_D	1.192	1.00
3_K	30_C	1.171	1.00
96_L	126_V	1.168	1.00
121_Q	157_E	1.165	1.00
3_K	193_L	1.160	1.00
173_E	195_V	1.150	1.00
79_A	106_Q	1.139	1.00
8_I	31_I	1.135	1.00
21_K	24_E	1.130	1.00
36_M	41_V	1.127	1.00
100_I	130_L	1.124	1.00
110_A	131_D	1.113	1.00
9_L	143_G	1.110	1.00
75_I	106_Q	1.095	1.00
103_I	110_A	1.086	1.00
40_F	91_E	1.085	1.00
85_I	132_L	1.080	1.00
88_V	99_T	1.067	1.00
102_L	106_Q	1.063	1.00
185_L	188_E	1.063	1.00
30_C	85_I	1.060	1.00
3_K	29_D	1.059	1.00
180_K	212_E	1.052	1.00
161_M	165_K	1.050	1.00
63_D	87_S	1.047	1.00
30_C	171_L	1.036	1.00
99_T	102_L	1.035	1.00
31_I	60_L	1.012	0.99
96_L	117_H	1.012	0.99
12_D	15_A	1.004	0.99
90_A	96_L	0.997	0.99
80_K	106_Q	0.994	0.99
100_I	129_D	0.989	0.99
25_K	207_K	0.987	0.99
100_I	104_K	0.985	0.99
112_V	126_V	0.983	0.99
8_I	33_I	0.982	0.99
46_I	50_I	0.979	0.99
72_D	102_L	0.977	0.99
125_H	157_E	0.973	0.99
130_L	133_V	0.968	0.99
24_E	58_T	0.949	0.99
48_P	77_A	0.945	0.99
77_A	80_K	0.930	0.99
58_T	62_L	0.928	0.99
162_A	172_I	0.925	0.99
49_L	52_E	0.921	0.99
100_I	126_V	0.919	0.99
196_A	200_V	0.918	0.99
137_T	147_F	0.911	0.99
109_K	171_L	0.909	0.99
33_I	46_I	0.906	0.99
156_K	160_R	0.905	0.99
14_A	53_A	0.903	0.99
156_K	188_E	0.903	0.99
49_L	53_A	0.901	0.99
127_F	168_K	0.901	0.99
100_I	110_A	0.900	0.99
157_E	161_M	0.899	0.99
18_N	22_D	0.897	0.99
209_A	212_E	0.897	0.99
173_E	193_L	0.893	0.99
208_K	211_S	0.892	0.99
55_R	58_T	0.891	0.99
87_S	111_G	0.885	0.98
160_R	163_D	0.883	0.98
174_V	191_A	0.881	0.98
4_V	210_I	0.870	0.98
206_R	209_A	0.870	0.98
152_L	189_A	0.867	0.98
95_H	139_N	0.866	0.98
155_I	174_V	0.863	0.98
97_H	150_S	0.861	0.98
29_D	61_P	0.860	0.98
10_S	45_T	0.858	0.98
20_I	31_I	0.858	0.98
186_V	194_L	0.858	0.98
40_F	118_T	0.857	0.98
196_A	199_A	0.857	0.98
191_A	194_L	0.840	0.98
183_A	187_I	0.839	0.98
88_V	100_I	0.837	0.98
93_C	99_T	0.837	0.98
16_L	50_I	0.837	0.98
68_I	74_Y	0.835	0.98
90_A	120_V	0.831	0.98
90_A	123_I	0.827	0.98
79_A	86_L	0.826	0.98
120_V	135_L	0.822	0.98
11_A	16_L	0.822	0.98
66_L	78_F	0.821	0.98
43_N	142_F	0.816	0.97
120_V	161_M	0.811	0.97
73_R	77_A	0.809	0.97
44_I	78_F	0.806	0.97
128_D	165_K	0.806	0.97
156_K	189_A	0.803	0.97
158_V	172_I	0.800	0.97
116_P	138_V	0.796	0.97
35_V	51_V	0.789	0.97
54_V	62_L	0.781	0.97
18_N	21_K	0.779	0.97
35_V	78_F	0.776	0.96
128_D	150_S	0.770	0.96
97_H	101_Q	0.767	0.96
158_V	162_A	0.762	0.96
120_V	157_E	0.761	0.96
52_E	56_P	0.758	0.96
159_K	170_L	0.749	0.96
125_H	128_D	0.747	0.96
88_V	93_C	0.739	0.95
155_I	172_I	0.735	0.95
39_H	73_R	0.734	0.95
143_G	177_G	0.729	0.95
153_P	157_E	0.729	0.95
123_I	133_V	0.722	0.95
199_A	209_A	0.721	0.95
9_L	177_G	0.721	0.95
15_A	19_E	0.718	0.95
118_T	122_V	0.708	0.94
180_K	209_A	0.707	0.94
53_A	56_P	0.700	0.94
24_E	27_G	0.700	0.94
132_L	193_L	0.697	0.94
96_L	99_T	0.697	0.94
161_M	164_E	0.696	0.94
155_I	191_A	0.694	0.94
6_P	28_A	0.692	0.93
151_V	154_K	0.691	0.93
152_L	186_V	0.689	0.93
10_S	198_S	0.684	0.93
45_T	48_P	0.681	0.93
11_A	19_E	0.677	0.93
143_G	197_G	0.676	0.93
20_I	24_E	0.667	0.92
200_V	210_I	0.660	0.92
27_G	211_S	0.658	0.92
77_A	81_A	0.656	0.92
103_I	108_V	0.649	0.91
174_V	178_V	0.643	0.91
130_L	170_L	0.643	0.91
30_C	132_L	0.642	0.91
66_L	86_L	0.642	0.91
90_A	114_L	0.642	0.91
183_A	213_I	0.640	0.91
200_V	206_R	0.639	0.90
112_V	123_I	0.636	0.90
95_H	117_H	0.630	0.90
23_V	28_A	0.630	0.90
67_M	89_H	0.627	0.90
148_I	151_V	0.626	0.90
203_Q	206_R	0.622	0.89
149_H	153_P	0.622	0.89
146_K	181_E	0.619	0.89
26_G	206_R	0.617	0.89
179_N	199_A	0.617	0.89
75_I	99_T	0.612	0.89
12_D	19_E	0.609	0.88
101_Q	104_K	0.608	0.88
116_P	140_P	0.604	0.88
182_T	213_I	0.602	0.88
180_K	213_I	0.601	0.88
88_V	112_V	0.599	0.87
162_A	165_K	0.590	0.87
165_K	170_L	0.590	0.87
124_E	165_K	0.588	0.86
123_I	126_V	0.586	0.86
114_L	135_L	0.585	0.86
21_K	57_V	0.583	0.86
23_V	206_R	0.579	0.86
52_E	77_A	0.577	0.85
138_V	145_Q	0.573	0.85
68_I	78_F	0.572	0.85
157_E	160_R	0.572	0.85
45_T	51_V	0.570	0.85
48_P	81_A	0.569	0.85
75_I	79_A	0.568	0.85
199_A	212_E	0.568	0.85
153_P	165_K	0.561	0.84
10_S	23_V	0.556	0.83
95_H	126_V	0.554	0.83
61_P	84_D	0.551	0.83
127_F	170_L	0.546	0.82
84_D	108_V	0.545	0.82
199_A	213_I	0.545	0.82
57_V	61_P	0.541	0.82
127_F	162_A	0.541	0.82
120_V	154_K	0.540	0.82
44_I	47_G	0.540	0.82
137_T	174_V	0.538	0.81
20_I	60_L	0.537	0.81
31_I	58_T	0.535	0.81
5_A	173_E	0.531	0.80
10_S	19_E	0.530	0.80
17_G	57_V	0.530	0.80
97_H	139_N	0.529	0.80
75_I	102_L	0.529	0.80
95_H	115_N	0.528	0.80
23_V	201_Y	0.527	0.80
76_P	105_E	0.524	0.80
129_D	150_S	0.523	0.79
75_I	103_I	0.521	0.79
133_V	170_L	0.521	0.79
127_F	133_V	0.521	0.79
104_K	129_D	0.520	0.79
43_N	145_Q	0.519	0.79
44_I	68_I	0.519	0.79
22_D	207_K	0.517	0.79
166_G	170_L	0.517	0.79
143_G	196_A	0.517	0.79
4_V	213_I	0.517	0.79
45_T	49_L	0.516	0.79
138_V	143_G	0.514	0.78
101_Q	139_N	0.512	0.78
46_I	49_L	0.510	0.78
71_P	88_V	0.510	0.78
98_R	102_L	0.510	0.78
178_V	194_L	0.509	0.78
38_G	74_Y	0.507	0.77
142_F	145_Q	0.507	0.77
33_I	64_V	0.507	0.77
84_D	109_K	0.507	0.77
10_S	177_G	0.506	0.77
10_S	143_G	0.506	0.77
70_E	94_P	0.505	0.77
33_I	54_V	0.504	0.77
161_M	168_K	0.503	0.77
120_V	124_E	0.501	0.77
152_L	182_T	0.500	0.76
146_K	179_N	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3cu2A	2	0.977	100	0.333	Contact Map
3ctlA	4	0.9862	100	0.431	Contact Map
3inpA	6	0.977	100	0.447	Contact Map
4df0A	2	0.8802	100	0.447	Contact Map
4muzA	2	0.9401	100	0.458	Contact Map
1rpxA	4	0.9954	100	0.458	Contact Map
1tqjA	4	0.977	100	0.462	Contact Map
2yyuA	2	0.9355	100	0.466	Contact Map
3w07A	2	0.9355	100	0.466	Contact Map
1dbtA	2	0.9447	100	0.468	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0077 seconds.