YFLK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YFLK - Uncharacterized protein YflK

UniProt:	O34542	Sequences: MKQERYSVLSLNLGKPQTLEYDGKKIETGIMKRPAKSAVMLYRENFEGDGQADLVNHGGPDKAVCVYPAEHYPFWEEFLSRPLSNAAFGENLTVAGLTEENVCIGDVFRLDEAVVQVSQPRQPCVKLAKKFGVKEMVLKVQQTGYTGFYFRVLEEGRVSPGANLELLSRGEKGISVQFANRINYHDAKNLTAIERILSEAALSESWRASFMKKKDRLLPVE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	221 (207)
Sequences:	1659 (1184)
Seq/√Len:	82.3

ECOLI - YIIM
BACSU - YFLK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
107_V	116_Q	4.584	1.00
114_V	167_L	3.144	1.00
38_A	159_S	2.836	1.00
102_V	108_F	2.826	1.00
114_V	154_E	2.818	1.00
66_V	150_F	2.780	1.00
43_R	155_E	2.708	1.00
62_K	149_Y	2.699	1.00
109_R	165_E	2.667	1.00
78_F	139_K	2.618	1.00
98_T	101_N	2.463	1.00
110_L	164_L	2.399	1.00
109_R	154_E	2.394	1.00
16_P	50_G	2.121	1.00
207_R	211_M	2.046	1.00
186_D	189_N	2.043	1.00
103_C	175_S	1.972	1.00
41_L	46_F	1.965	1.00
113_A	158_V	1.945	1.00
159_S	162_A	1.917	1.00
128_A	137_V	1.915	1.00
166_L	169_R	1.855	1.00
116_Q	153_L	1.802	1.00
41_L	113_A	1.802	1.00
15_K	50_G	1.785	1.00
66_V	94_V	1.772	1.00
190_L	194_E	1.759	1.00
109_R	167_L	1.757	1.00
116_Q	151_R	1.750	1.00
40_M	47_E	1.748	1.00
41_L	158_V	1.726	1.00
67_Y	75_W	1.715	1.00
100_E	177_Q	1.685	1.00
70_E	96_G	1.685	1.00
107_V	153_L	1.683	1.00
8_V	92_L	1.677	1.00
12_N	93_T	1.673	1.00
64_V	115_V	1.670	1.00
117_V	150_F	1.651	1.00
178_F	195_R	1.645	1.00
110_L	115_V	1.616	1.00
92_L	158_V	1.601	1.00
13_L	35_A	1.562	1.00
29_G	50_G	1.558	1.00
181_R	186_D	1.557	1.00
211_M	215_D	1.522	0.99
118_S	151_R	1.517	0.99
114_V	153_L	1.517	0.99
131_F	136_M	1.516	0.99
61_D	151_R	1.511	0.99
44_E	54_L	1.503	0.99
26_I	125_V	1.464	0.99
70_E	94_V	1.454	0.99
31_M	130_K	1.434	0.99
71_H	143_T	1.411	0.99
112_E	162_A	1.397	0.99
61_D	204_E	1.396	0.99
38_A	157_R	1.391	0.99
53_D	56_N	1.390	0.99
68_P	71_H	1.368	0.99
17_Q	31_M	1.359	0.99
28_T	31_M	1.347	0.99
112_E	157_R	1.331	0.99
64_V	158_V	1.328	0.99
41_L	115_V	1.326	0.99
18_T	27_E	1.323	0.99
106_D	169_R	1.310	0.98
52_A	126_K	1.310	0.98
79_L	83_L	1.304	0.98
76_E	82_P	1.303	0.98
92_L	110_L	1.276	0.98
103_C	173_G	1.274	0.98
109_R	114_V	1.272	0.98
62_K	122_Q	1.266	0.98
65_C	140_V	1.263	0.98
46_F	64_V	1.258	0.98
68_P	99_E	1.224	0.98
40_M	157_R	1.219	0.97
16_P	29_G	1.216	0.97
104_I	179_A	1.203	0.97
103_C	169_R	1.192	0.97
17_Q	33_R	1.185	0.97
43_R	60_P	1.183	0.97
110_L	158_V	1.174	0.97
16_P	27_E	1.173	0.97
30_I	89_G	1.157	0.96
74_F	78_F	1.156	0.96
107_V	114_V	1.134	0.96
103_C	106_D	1.112	0.96
103_C	171_E	1.112	0.96
71_H	99_E	1.099	0.95
119_Q	203_S	1.093	0.95
135_E	139_K	1.090	0.95
133_V	139_K	1.090	0.95
113_A	155_E	1.087	0.95
40_M	112_E	1.083	0.95
182_I	196_I	1.076	0.95
127_L	140_V	1.070	0.95
128_A	135_E	1.068	0.95
40_M	155_E	1.065	0.94
138_L	142_Q	1.054	0.94
7_S	95_A	1.053	0.94
189_N	192_A	1.045	0.94
42_Y	47_E	1.044	0.94
37_S	160_P	1.030	0.93
69_A	73_P	1.029	0.93
9_L	95_A	1.028	0.93
16_P	52_A	1.026	0.93
104_I	176_V	1.021	0.93
108_F	150_F	1.013	0.93
37_S	159_S	1.006	0.93
112_E	154_E	1.002	0.92
116_Q	201_A	0.984	0.92
12_N	86_A	0.980	0.92
115_V	150_F	0.979	0.92
174_I	199_E	0.979	0.92
51_Q	54_L	0.963	0.91
68_P	98_T	0.962	0.91
104_I	120_P	0.953	0.90
94_V	164_L	0.951	0.90
103_C	172_K	0.949	0.90
86_A	149_Y	0.947	0.90
62_K	119_Q	0.942	0.90
102_V	150_F	0.939	0.90
87_A	131_F	0.929	0.89
42_Y	155_E	0.927	0.89
39_V	46_F	0.924	0.89
97_L	108_F	0.924	0.89
193_I	210_F	0.919	0.89
63_A	152_V	0.918	0.89
29_G	52_A	0.911	0.88
72_Y	93_T	0.904	0.88
45_N	63_A	0.901	0.88
11_L	39_V	0.898	0.88
204_E	211_M	0.894	0.87
108_F	166_L	0.880	0.86
122_Q	141_Q	0.876	0.86
174_I	178_F	0.874	0.86
20_E	23_G	0.854	0.85
179_A	196_I	0.853	0.85
16_P	51_Q	0.852	0.85
11_L	46_F	0.848	0.84
111_D	162_A	0.845	0.84
70_E	98_T	0.834	0.83
44_E	51_Q	0.831	0.83
108_F	164_L	0.827	0.83
70_E	95_A	0.826	0.83
8_V	110_L	0.823	0.83
74_F	145_Y	0.821	0.82
125_V	129_K	0.819	0.82
144_G	180_N	0.811	0.82
8_V	113_A	0.805	0.81
41_L	64_V	0.799	0.81
67_Y	71_H	0.798	0.81
102_V	148_F	0.794	0.80
66_V	92_L	0.791	0.80
18_T	25_K	0.785	0.80
204_E	208_A	0.784	0.79
141_Q	180_N	0.782	0.79
9_L	85_N	0.779	0.79
74_F	77_E	0.771	0.78
193_I	197_L	0.767	0.78
191_T	194_E	0.762	0.77
116_Q	168_S	0.761	0.77
103_C	174_I	0.757	0.77
116_Q	179_A	0.757	0.77
62_K	118_S	0.750	0.76
128_A	136_M	0.749	0.76
194_E	214_K	0.748	0.76
86_A	130_K	0.743	0.76
102_V	117_V	0.740	0.75
194_E	198_S	0.735	0.75
188_K	193_I	0.729	0.74
71_H	100_E	0.728	0.74
8_V	162_A	0.727	0.74
146_T	180_N	0.726	0.74
75_W	145_Y	0.721	0.73
14_G	29_G	0.719	0.73
190_L	214_K	0.719	0.73
88_F	140_V	0.718	0.73
65_C	180_N	0.713	0.73
103_C	170_G	0.712	0.73
66_V	148_F	0.707	0.72
177_Q	181_R	0.706	0.72
179_A	206_W	0.703	0.72
66_V	115_V	0.702	0.71
65_C	127_L	0.701	0.71
205_S	209_S	0.701	0.71
19_L	28_T	0.699	0.71
178_F	192_A	0.698	0.71
75_W	88_F	0.695	0.71
208_A	211_M	0.691	0.70
67_Y	88_F	0.690	0.70
13_L	37_S	0.688	0.70
46_F	110_L	0.684	0.70
107_V	168_S	0.680	0.69
186_D	214_K	0.678	0.69
133_V	136_M	0.677	0.69
19_L	26_I	0.675	0.69
80_S	83_L	0.674	0.68
51_Q	62_K	0.670	0.68
44_E	60_P	0.666	0.67
170_G	201_A	0.663	0.67
106_D	166_L	0.663	0.67
173_G	178_F	0.660	0.67
127_L	141_Q	0.659	0.67
51_Q	137_V	0.659	0.67
179_A	210_F	0.655	0.66
199_E	210_F	0.655	0.66
29_G	32_K	0.653	0.66
46_F	158_V	0.652	0.66
28_T	74_F	0.652	0.66
81_R	133_V	0.651	0.66
104_I	203_S	0.647	0.65
65_C	131_F	0.647	0.65
119_Q	206_W	0.642	0.65
61_D	150_F	0.640	0.64
9_L	12_N	0.639	0.64
10_S	93_T	0.637	0.64
50_G	54_L	0.637	0.64
192_A	195_R	0.637	0.64
26_I	129_K	0.631	0.63
122_Q	184_Y	0.624	0.62
53_D	125_V	0.623	0.62
61_D	203_S	0.623	0.62
108_F	115_V	0.618	0.62
51_Q	126_K	0.615	0.61
195_R	198_S	0.612	0.61
94_V	150_F	0.611	0.61
151_R	196_I	0.611	0.61
71_H	98_T	0.604	0.60
120_P	203_S	0.602	0.60
135_E	142_Q	0.599	0.59
137_V	141_Q	0.595	0.59
172_K	198_S	0.594	0.59
196_I	210_F	0.594	0.59
27_E	200_A	0.590	0.58
182_I	192_A	0.590	0.58
7_S	163_N	0.589	0.58
69_A	72_Y	0.588	0.58
99_E	106_D	0.588	0.58
181_R	189_N	0.586	0.58
10_S	86_A	0.586	0.58
138_L	141_Q	0.584	0.57
69_A	93_T	0.583	0.57
56_N	62_K	0.582	0.57
171_E	201_A	0.579	0.57
75_W	139_K	0.577	0.57
86_A	92_L	0.577	0.57
19_L	24_K	0.576	0.56
32_K	51_Q	0.576	0.56
102_V	106_D	0.574	0.56
23_G	27_E	0.573	0.56
65_C	148_F	0.571	0.56
104_I	175_S	0.571	0.56
39_V	48_G	0.570	0.56
71_H	75_W	0.569	0.55
168_S	171_E	0.569	0.55
67_Y	72_Y	0.568	0.55
197_L	200_A	0.568	0.55
30_I	65_C	0.565	0.55
187_A	213_K	0.563	0.55
181_R	192_A	0.561	0.54
127_L	136_M	0.559	0.54
120_P	125_V	0.558	0.54
75_W	78_F	0.558	0.54
120_P	179_A	0.557	0.54
148_F	174_I	0.552	0.53
125_V	174_I	0.548	0.53
28_T	94_V	0.548	0.53
120_P	184_Y	0.546	0.52
35_A	39_V	0.546	0.52
99_E	102_V	0.545	0.52
99_E	148_F	0.544	0.52
128_A	131_F	0.543	0.52
9_L	93_T	0.541	0.52
193_I	214_K	0.539	0.52
88_F	210_F	0.539	0.52
43_R	142_Q	0.539	0.52
83_L	146_T	0.538	0.51
69_A	85_N	0.537	0.51
175_S	180_N	0.534	0.51
97_L	101_N	0.533	0.51
57_H	123_P	0.531	0.50
49_D	58_G	0.530	0.50
66_V	117_V	0.529	0.50
113_A	157_R	0.529	0.50
175_S	178_F	0.528	0.50
126_K	131_F	0.528	0.50
140_V	180_N	0.526	0.50
39_V	63_A	0.526	0.50
67_Y	143_T	0.525	0.50
74_F	143_T	0.524	0.50
122_Q	127_L	0.523	0.49
51_Q	119_Q	0.521	0.49
97_L	102_V	0.518	0.49
54_L	92_L	0.517	0.49
38_A	160_P	0.516	0.49
94_V	97_L	0.513	0.48
9_L	69_A	0.512	0.48
44_E	155_E	0.511	0.48
130_K	136_M	0.510	0.48
37_S	161_G	0.509	0.48
141_Q	184_Y	0.508	0.47
36_K	160_P	0.508	0.47
68_P	94_V	0.508	0.47
11_L	37_S	0.506	0.47
29_G	213_K	0.505	0.47
24_K	55_V	0.501	0.47
81_R	142_Q	0.500	0.46

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1o65A	1	0.9186	100	0.308	Contact Map
1oruA	2	0.7149	100	0.568	Contact Map
1y8oB	1	0.4253	65.1	0.952	Contact Map
3crkC	1	0.3756	52.6	0.955	Contact Map
1zy8K	1	0.0724	31.6	0.961	Contact Map
1pmrA	1	0.3529	19.7	0.964	Contact Map
2dncA	1	0.4299	14.7	0.966	Contact Map
2dneA	1	0.4751	14.3	0.967	Contact Map
1z6hA	1	0.3167	14.3	0.967	Contact Map
2mkxA	1	0.2308	13.3	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.