YNGL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YNGL - UPF0713 protein YngL

UniProt:	O34506	Sequences: MDRLSFLTFIMLILASYRLTHLIVFDKITEFIRKPFMKKKRIVDQNGHVDEKSVPASNFGYMLNCYWCAGVWCAILIGLGYLFLPRIAIPLIFILAIAGAQAILETAVGVGVKLIDVLKSLQTMMNDKKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	130 (106)
Sequences:	135 (110)
Seq/√Len:	10.7

BACSU - YNGL YJCA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_F	66_Y	4.768	1.00
19_L	95_L	4.300	0.99
80_G	88_A	3.795	0.99
35_P	63_L	3.633	0.98
44_D	48_H	2.344	0.82
22_L	28_I	2.045	0.72
30_E	45_Q	1.922	0.67
74_A	108_V	1.906	0.66
59_F	99_G	1.856	0.64
41_R	49_V	1.832	0.63
21_H	39_K	1.791	0.61
4_L	21_H	1.768	0.60
11_M	92_I	1.765	0.60
4_L	12_L	1.684	0.56
34_K	91_L	1.676	0.56
21_H	61_Y	1.674	0.56
35_P	90_P	1.588	0.51
31_F	35_P	1.575	0.51
50_D	56_A	1.547	0.50
44_D	47_G	1.498	0.47
9_F	96_A	1.486	0.47
39_K	94_I	1.395	0.42
5_S	95_L	1.389	0.42
78_G	90_P	1.380	0.42
83_F	108_V	1.368	0.41
93_F	97_I	1.367	0.41
76_L	108_V	1.365	0.41
9_F	100_A	1.343	0.40
31_F	94_I	1.288	0.38
103_I	108_V	1.240	0.35
38_K	79_L	1.230	0.35
43_V	47_G	1.226	0.35
5_S	106_T	1.221	0.35
95_L	98_A	1.216	0.34
71_V	76_L	1.209	0.34
66_Y	83_F	1.188	0.33
17_Y	61_Y	1.186	0.33
13_I	101_Q	1.174	0.33
21_H	44_D	1.152	0.32
74_A	97_I	1.143	0.31
6_F	99_G	1.138	0.31
58_N	106_T	1.133	0.31
13_I	89_I	1.128	0.31
22_L	29_T	1.116	0.30
56_A	64_N	1.114	0.30
27_K	103_I	1.105	0.30
43_V	51_E	1.088	0.29
12_L	54_V	1.084	0.29
76_L	92_I	1.070	0.28
38_K	94_I	1.060	0.28
27_K	61_Y	1.056	0.28
52_K	69_A	1.051	0.28
25_F	102_A	1.023	0.27
17_Y	64_N	1.002	0.26
16_S	74_A	0.999	0.26
32_I	106_T	0.990	0.25
25_F	46_N	0.988	0.25
27_K	31_F	0.974	0.25
12_L	88_A	0.963	0.24
37_M	78_G	0.962	0.24
37_M	64_N	0.958	0.24
7_L	74_A	0.953	0.24
25_F	105_E	0.944	0.24
13_I	80_G	0.937	0.24
17_Y	60_G	0.929	0.23
39_K	52_K	0.919	0.23
29_T	63_L	0.902	0.22
14_L	105_E	0.897	0.22
62_M	90_P	0.893	0.22
56_A	83_F	0.890	0.22
8_T	30_E	0.873	0.21
92_I	95_L	0.871	0.21
45_Q	76_L	0.863	0.21
57_S	84_L	0.863	0.21
29_T	32_I	0.863	0.21
76_L	104_L	0.860	0.21
21_H	52_K	0.836	0.20
12_L	79_L	0.818	0.20
47_G	50_D	0.818	0.20
59_F	96_A	0.817	0.20
41_R	77_I	0.814	0.20
11_M	51_E	0.804	0.19
8_T	103_I	0.804	0.19
23_I	81_Y	0.798	0.19
13_I	99_G	0.781	0.19
11_M	50_D	0.769	0.18
71_V	97_I	0.765	0.18
21_H	41_R	0.763	0.18
10_I	34_K	0.761	0.18
42_I	64_N	0.732	0.17
7_L	32_I	0.725	0.17
64_N	109_G	0.721	0.17
10_I	45_Q	0.716	0.17
71_V	95_L	0.715	0.17
50_D	102_A	0.707	0.17
47_G	51_E	0.705	0.17
21_H	38_K	0.702	0.17
47_G	52_K	0.688	0.16
32_I	82_L	0.687	0.16
75_I	95_L	0.686	0.16
34_K	66_Y	0.682	0.16
5_S	91_L	0.682	0.16
37_M	61_Y	0.682	0.16
8_T	45_Q	0.679	0.16
11_M	61_Y	0.679	0.16
47_G	70_G	0.677	0.16
30_E	55_P	0.677	0.16
75_I	94_I	0.676	0.16
77_I	92_I	0.671	0.16
66_Y	105_E	0.665	0.16
39_K	51_E	0.655	0.15
43_V	79_L	0.653	0.15
94_I	107_A	0.648	0.15
43_V	66_Y	0.647	0.15
43_V	48_H	0.646	0.15
20_T	35_P	0.643	0.15
32_I	76_L	0.638	0.15
23_I	104_L	0.635	0.15
58_N	104_L	0.635	0.15
80_G	89_I	0.634	0.15
96_A	104_L	0.632	0.15
76_L	83_F	0.615	0.14
43_V	46_N	0.611	0.14
60_G	64_N	0.605	0.14
20_T	36_F	0.604	0.14
41_R	86_R	0.601	0.14
27_K	79_L	0.587	0.14
46_N	76_L	0.586	0.14
56_A	97_I	0.586	0.14
75_I	97_I	0.579	0.14
17_Y	96_A	0.577	0.14
32_I	77_I	0.577	0.14
6_F	84_L	0.575	0.13
19_L	102_A	0.569	0.13
23_I	73_C	0.569	0.13
63_L	70_G	0.564	0.13
16_S	84_L	0.562	0.13
14_L	100_A	0.561	0.13
76_L	96_A	0.561	0.13
13_I	16_S	0.560	0.13
69_A	91_L	0.551	0.13
16_S	55_P	0.549	0.13
45_Q	75_I	0.548	0.13
37_M	55_P	0.545	0.13
74_A	101_Q	0.543	0.13
11_M	64_N	0.541	0.13
4_L	8_T	0.537	0.13
23_I	58_N	0.536	0.13
51_E	59_F	0.531	0.13
58_N	82_L	0.531	0.13
35_P	70_G	0.529	0.12
64_N	69_A	0.514	0.12
30_E	100_A	0.509	0.12
7_L	78_G	0.507	0.12
102_A	106_T	0.506	0.12
101_Q	109_G	0.506	0.12
7_L	23_I	0.503	0.12
6_F	56_A	0.503	0.12
8_T	50_D	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zxeA	1	0.3385	8.7	0.958	Contact Map
3ixzA	1	0.3385	8	0.959	Contact Map
3j01B	1	0.5385	7.2	0.96	Contact Map
1q90L	1	0.2462	4.5	0.964	Contact Map
3tx3A	2	0.8615	4.5	0.964	Contact Map
4xk8I	1	0.2231	3.9	0.965	Contact Map
4nv5A	1	0.9462	3.8	0.965	Contact Map
2mfrA	1	0.3	2.8	0.967	Contact Map
4q9hA	1	0.9846	2.6	0.968	Contact Map
4f4cA	1	0.9615	2.3	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.