YLBP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLBP - Uncharacterized N-acetyltransferase YlbP

UniProt:	O34468	Sequences: MTKVERLLINYKTLEEFKKFKEYGIQELSMLEELQDNIIENDSTSPFYGIYFGDKLVARMSLYQVNGKSNPYFDNRQDYLELWKLEVLPGYQNRGYGRALVEFAKSFKMPIRTNPRMKSAEFWNKMNFKTVKYDMARDKGENPLIWHPDMDREMTPGESA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (150)
Sequences:	122 (70)
Seq/√Len:	5.7

BACSU - YLBP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_E	61_S	3.840	0.91
115_P	144_L	3.690	0.89
21_K	31_L	3.054	0.77
80_L	107_F	2.539	0.62
35_Q	107_F	2.533	0.62
6_R	125_K	2.434	0.59
43_S	82_L	2.218	0.52
65_V	139_K	2.178	0.50
75_N	150_M	2.169	0.50
69_S	147_H	1.942	0.42
57_V	82_L	1.886	0.40
42_D	78_D	1.809	0.38
39_I	82_L	1.798	0.37
79_Y	150_M	1.756	0.36
72_Y	140_G	1.733	0.35
21_K	102_E	1.727	0.35
57_V	121_E	1.715	0.35
19_K	55_K	1.692	0.34
102_E	134_D	1.628	0.32
32_E	81_E	1.627	0.32
91_Y	107_F	1.584	0.31
39_I	129_K	1.580	0.31
137_R	143_P	1.549	0.30
115_P	126_M	1.502	0.28
29_S	101_V	1.499	0.28
14_L	38_I	1.498	0.28
99_A	121_E	1.486	0.28
103_F	107_F	1.470	0.27
42_D	69_S	1.443	0.27
58_A	100_L	1.442	0.27
18_K	135_M	1.409	0.26
52_F	96_Y	1.397	0.25
114_N	142_N	1.390	0.25
112_R	150_M	1.358	0.24
95_G	103_F	1.357	0.24
19_K	31_L	1.351	0.24
33_E	38_I	1.350	0.24
115_P	139_K	1.338	0.24
140_G	143_P	1.329	0.24
34_L	45_S	1.329	0.24
44_T	132_K	1.328	0.24
39_I	43_S	1.324	0.24
58_A	96_Y	1.302	0.23
133_Y	137_R	1.301	0.23
25_I	130_T	1.297	0.23
139_K	144_L	1.265	0.22
9_I	132_K	1.251	0.22
125_K	130_T	1.226	0.21
83_W	140_G	1.225	0.21
41_N	44_T	1.222	0.21
53_G	105_K	1.220	0.21
23_Y	26_Q	1.219	0.21
14_L	57_V	1.197	0.21
98_R	126_M	1.195	0.21
36_D	55_K	1.189	0.20
64_Q	78_D	1.181	0.20
95_G	109_M	1.169	0.20
118_K	144_L	1.168	0.20
29_S	81_E	1.165	0.20
72_Y	131_V	1.159	0.20
115_P	135_M	1.155	0.20
70_N	75_N	1.149	0.20
5_E	58_A	1.147	0.19
74_D	106_S	1.142	0.19
64_Q	109_M	1.139	0.19
53_G	60_M	1.136	0.19
114_N	143_P	1.128	0.19
37_N	124_N	1.127	0.19
42_D	82_L	1.115	0.19
33_E	42_D	1.107	0.19
107_F	144_L	1.098	0.18
78_D	141_E	1.081	0.18
3_K	19_K	1.081	0.18
93_N	129_K	1.080	0.18
99_A	125_K	1.068	0.18
44_T	123_W	1.064	0.18
9_I	108_K	1.063	0.18
96_Y	147_H	1.060	0.18
31_L	117_M	1.037	0.17
3_K	94_R	1.037	0.17
18_K	31_L	1.033	0.17
83_W	143_P	1.031	0.17
40_E	113_T	1.021	0.17
5_E	89_P	1.006	0.17
52_F	94_R	0.993	0.16
133_Y	143_P	0.988	0.16
108_K	152_R	0.988	0.16
18_K	118_K	0.980	0.16
77_Q	151_D	0.979	0.16
92_Q	95_G	0.969	0.16
83_W	137_R	0.964	0.16
39_I	91_Y	0.964	0.16
22_E	118_K	0.955	0.16
138_D	143_P	0.941	0.15
26_Q	142_N	0.935	0.15
98_R	102_E	0.933	0.15
115_P	119_S	0.922	0.15
93_N	132_K	0.918	0.15
11_Y	58_A	0.908	0.15
92_Q	103_F	0.908	0.15
92_Q	118_K	0.907	0.15
6_R	39_I	0.903	0.15
16_E	61_S	0.901	0.15
114_N	137_R	0.890	0.14
33_E	89_P	0.886	0.14
42_D	102_E	0.880	0.14
42_D	57_V	0.879	0.14
22_E	91_Y	0.873	0.14
89_P	96_Y	0.870	0.14
18_K	136_A	0.869	0.14
25_I	134_D	0.861	0.14
38_I	108_K	0.859	0.14
136_A	150_M	0.857	0.14
9_I	38_I	0.850	0.14
41_N	113_T	0.847	0.14
25_I	147_H	0.846	0.14
9_I	76_R	0.844	0.14
120_A	145_I	0.833	0.14
8_L	35_Q	0.831	0.14
18_K	92_Q	0.831	0.14
75_N	145_I	0.830	0.13
63_Y	81_E	0.828	0.13
19_K	136_A	0.827	0.13
54_D	99_A	0.827	0.13
22_E	80_L	0.827	0.13
131_V	145_I	0.816	0.13
11_Y	96_Y	0.814	0.13
75_N	114_N	0.812	0.13
137_R	142_N	0.808	0.13
129_K	147_H	0.807	0.13
70_N	77_Q	0.797	0.13
16_E	81_E	0.792	0.13
111_I	117_M	0.791	0.13
14_L	61_S	0.790	0.13
80_L	108_K	0.783	0.13
25_I	121_E	0.783	0.13
24_G	56_L	0.771	0.13
29_S	123_W	0.769	0.13
53_G	119_S	0.763	0.12
5_E	66_N	0.761	0.12
9_I	91_Y	0.747	0.12
43_S	101_V	0.746	0.12
44_T	102_E	0.746	0.12
64_Q	71_P	0.744	0.12
101_V	113_T	0.738	0.12
26_Q	135_M	0.732	0.12
78_D	106_S	0.727	0.12
14_L	82_L	0.724	0.12
51_Y	63_Y	0.724	0.12
66_N	147_H	0.719	0.12
48_Y	55_K	0.714	0.12
8_L	131_V	0.713	0.12
54_D	126_M	0.713	0.12
70_N	151_D	0.713	0.12
29_S	113_T	0.713	0.12
36_D	103_F	0.711	0.12
43_S	140_G	0.711	0.12
121_E	124_N	0.709	0.12
19_K	36_D	0.709	0.12
111_I	115_P	0.706	0.12
31_L	89_P	0.705	0.12
75_N	143_P	0.705	0.12
113_T	123_W	0.703	0.12
18_K	115_P	0.702	0.12
6_R	42_D	0.692	0.11
81_E	113_T	0.688	0.11
63_Y	97_G	0.683	0.11
69_S	130_T	0.682	0.11
81_E	101_V	0.680	0.11
75_N	151_D	0.674	0.11
25_I	36_D	0.672	0.11
35_Q	91_Y	0.664	0.11
54_D	93_N	0.663	0.11
33_E	127_N	0.661	0.11
26_Q	119_S	0.649	0.11
51_Y	81_E	0.648	0.11
83_W	138_D	0.648	0.11
50_I	103_F	0.638	0.11
71_P	139_K	0.631	0.11
35_Q	82_L	0.629	0.11
117_M	120_A	0.620	0.10
44_T	103_F	0.618	0.10
21_K	108_K	0.616	0.10
117_M	129_K	0.616	0.10
11_Y	132_K	0.613	0.10
135_M	144_L	0.609	0.10
8_L	135_M	0.607	0.10
89_P	101_V	0.599	0.10
14_L	27_E	0.597	0.10
44_T	129_K	0.597	0.10
111_I	118_K	0.592	0.10
11_Y	50_I	0.592	0.10
96_Y	144_L	0.581	0.10
103_F	124_N	0.579	0.10
92_Q	144_L	0.576	0.10
9_I	79_Y	0.575	0.10
41_N	123_W	0.571	0.10
102_E	131_V	0.570	0.10
18_K	111_I	0.567	0.10
102_E	108_K	0.566	0.10
31_L	65_V	0.564	0.10
65_V	76_R	0.562	0.10
22_E	101_V	0.561	0.10
74_D	109_M	0.560	0.10
8_L	36_D	0.554	0.10
6_R	82_L	0.554	0.10
121_E	129_K	0.554	0.10
37_N	101_V	0.541	0.09
80_L	126_M	0.540	0.09
90_G	108_K	0.540	0.09
55_K	130_T	0.539	0.09
121_E	130_T	0.536	0.09
72_Y	83_W	0.534	0.09
18_K	117_M	0.532	0.09
52_F	64_Q	0.531	0.09
106_S	121_E	0.525	0.09
133_Y	138_D	0.523	0.09
32_E	98_R	0.520	0.09
129_K	132_K	0.519	0.09
35_Q	89_P	0.518	0.09
69_S	75_N	0.518	0.09
83_W	133_Y	0.517	0.09
31_L	102_E	0.513	0.09
102_E	129_K	0.512	0.09
41_N	52_F	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2pr1A	3	0.95	99.8	0.751	Contact Map
2jdcA	1	0.8688	98.4	0.883	Contact Map
1q2yA	1	0.8313	98.4	0.883	Contact Map
2q0yA	2	0.8375	98.4	0.884	Contact Map
3i3gA	2	0.8187	98.3	0.885	Contact Map
2atrA	2	0.7688	98.3	0.885	Contact Map
1ufhA	3	0.7875	98.3	0.885	Contact Map
3exnA	1	0.8438	98.3	0.886	Contact Map
3t9yA	2	0.7625	98.3	0.886	Contact Map
1y7rA	2	0.7812	98.3	0.887	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.