YTRI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTRI - Sporulation membrane protein YtrI

UniProt:	O34460	Sequences: MRVPQHYKKPGWQRFFAGMMCGAVISWFFFLFTYGTFQEEQVSLIEKQKEHVKDLNNQISIYQEDLHKLNEDNKRKLLIQSVSVKLLNGDKYKISQPDKTKFEEHVKDDISEVITKDIESVYQTKDLLKRTIENKVYMINEKKYEATVRELIIYTRLTVELEISFAT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	167 (164)
Sequences:	109 (97)
Seq/√Len:	7.6

BACSU - YTRI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
31_L	84_V	3.163	0.89
129_K	150_E	2.971	0.85
149_R	162_E	2.727	0.80
110_I	113_V	2.444	0.72
113_V	157_L	2.416	0.71
2_R	27_W	2.274	0.66
23_A	26_S	2.267	0.66
65_D	74_K	2.252	0.65
19_M	34_Y	2.220	0.64
37_F	163_I	2.211	0.64
29_F	90_D	2.153	0.61
74_K	128_L	2.069	0.58
15_F	135_K	2.044	0.57
118_I	154_Y	2.032	0.57
2_R	154_Y	2.007	0.56
32_F	36_T	1.900	0.51
6_H	94_I	1.884	0.51
51_H	56_N	1.863	0.50
92_Y	115_T	1.859	0.50
129_K	148_V	1.824	0.48
55_L	75_R	1.801	0.48
147_T	164_S	1.783	0.47
1_M	4_P	1.767	0.46
6_H	11_G	1.751	0.46
109_D	128_L	1.723	0.44
78_L	82_V	1.683	0.43
27_W	45_I	1.654	0.42
2_R	45_I	1.640	0.41
52_V	148_V	1.639	0.41
79_I	118_I	1.619	0.40
33_T	163_I	1.609	0.40
121_V	146_A	1.606	0.40
33_T	98_D	1.604	0.40
113_V	128_L	1.592	0.39
147_T	162_E	1.589	0.39
77_L	101_K	1.559	0.38
24_V	146_A	1.535	0.37
79_I	151_L	1.510	0.36
122_Y	129_K	1.506	0.36
16_F	144_Y	1.504	0.36
5_Q	13_Q	1.503	0.36
30_F	121_V	1.495	0.36
87_L	126_D	1.484	0.35
94_I	99_K	1.462	0.34
70_N	77_L	1.455	0.34
38_Q	41_Q	1.427	0.33
132_I	157_L	1.419	0.33
7_Y	13_Q	1.407	0.33
48_Q	52_V	1.406	0.33
45_I	48_Q	1.390	0.32
40_E	157_L	1.388	0.32
45_I	49_K	1.384	0.32
32_F	95_S	1.368	0.31
48_Q	70_N	1.367	0.31
26_S	29_F	1.359	0.31
62_Y	66_L	1.354	0.31
44_L	102_F	1.349	0.31
25_I	149_R	1.346	0.30
142_K	153_I	1.334	0.30
74_K	118_I	1.333	0.30
107_K	161_L	1.332	0.30
44_L	148_V	1.325	0.30
3_V	7_Y	1.318	0.29
5_Q	161_L	1.256	0.27
19_M	29_F	1.225	0.26
2_R	142_K	1.210	0.26
70_N	80_Q	1.205	0.26
25_I	83_S	1.188	0.25
17_A	30_F	1.187	0.25
47_K	86_L	1.180	0.25
93_K	110_I	1.172	0.25
153_I	164_S	1.165	0.25
142_K	150_E	1.150	0.24
93_K	124_T	1.139	0.24
57_N	77_L	1.132	0.24
62_Y	115_T	1.115	0.23
16_F	106_V	1.100	0.23
73_N	126_D	1.091	0.23
90_D	143_K	1.086	0.22
86_L	92_Y	1.078	0.22
2_R	155_T	1.056	0.22
100_T	115_T	1.040	0.21
79_I	153_I	1.026	0.21
27_W	134_N	1.014	0.20
15_F	78_L	1.012	0.20
26_S	122_Y	1.004	0.20
39_E	113_V	0.994	0.20
16_F	97_P	0.980	0.20
2_R	48_Q	0.976	0.19
72_D	113_V	0.972	0.19
48_Q	155_T	0.958	0.19
64_E	114_I	0.958	0.19
8_K	12_W	0.938	0.19
73_N	80_Q	0.922	0.18
60_S	102_F	0.921	0.18
51_H	83_S	0.909	0.18
92_Y	140_N	0.902	0.18
111_S	160_E	0.900	0.18
31_L	120_S	0.898	0.18
138_M	141_E	0.894	0.18
52_V	55_L	0.885	0.17
20_M	78_L	0.885	0.17
45_I	156_R	0.882	0.17
84_V	159_V	0.876	0.17
40_E	111_S	0.866	0.17
79_I	82_V	0.863	0.17
16_F	146_A	0.863	0.17
29_F	104_E	0.861	0.17
81_S	100_T	0.860	0.17
117_D	131_T	0.860	0.17
33_T	104_E	0.858	0.17
107_K	110_I	0.851	0.17
122_Y	125_K	0.844	0.16
27_W	142_K	0.843	0.16
144_Y	153_I	0.840	0.16
49_K	148_V	0.839	0.16
39_E	60_S	0.838	0.16
25_I	84_V	0.833	0.16
38_Q	109_D	0.832	0.16
119_E	139_I	0.828	0.16
74_K	112_E	0.826	0.16
68_K	79_I	0.823	0.16
88_N	134_N	0.818	0.16
28_F	148_V	0.818	0.16
28_F	59_I	0.817	0.16
54_D	132_I	0.815	0.16
93_K	157_L	0.813	0.16
86_L	160_E	0.811	0.16
18_G	27_W	0.806	0.16
104_E	141_E	0.800	0.15
120_S	154_Y	0.797	0.15
110_I	123_Q	0.795	0.15
42_V	61_I	0.794	0.15
41_Q	44_L	0.792	0.15
86_L	157_L	0.790	0.15
112_E	128_L	0.786	0.15
31_L	157_L	0.780	0.15
72_D	118_I	0.780	0.15
27_W	48_Q	0.769	0.15
79_I	157_L	0.766	0.15
72_D	131_T	0.764	0.15
125_K	150_E	0.764	0.15
51_H	75_R	0.761	0.15
34_Y	100_T	0.757	0.15
27_W	30_F	0.755	0.15
16_F	82_V	0.753	0.14
20_M	67_H	0.738	0.14
116_K	163_I	0.734	0.14
18_G	133_E	0.730	0.14
78_L	146_A	0.728	0.14
44_L	49_K	0.728	0.14
37_F	146_A	0.726	0.14
31_L	113_V	0.722	0.14
52_V	132_I	0.720	0.14
110_I	157_L	0.719	0.14
1_M	22_G	0.715	0.14
13_Q	42_V	0.710	0.14
28_F	94_I	0.708	0.14
76_K	94_I	0.706	0.14
47_K	125_K	0.705	0.14
141_E	151_L	0.689	0.13
73_N	155_T	0.687	0.13
64_E	68_K	0.686	0.13
18_G	22_G	0.683	0.13
120_S	123_Q	0.683	0.13
6_H	87_L	0.680	0.13
37_F	41_Q	0.676	0.13
32_F	128_L	0.674	0.13
79_I	162_E	0.668	0.13
47_K	140_N	0.667	0.13
108_D	114_I	0.663	0.13
69_L	88_N	0.662	0.13
15_F	18_G	0.657	0.13
2_R	115_T	0.653	0.13
76_K	162_E	0.652	0.13
7_Y	161_L	0.651	0.13
126_D	140_N	0.646	0.12
84_V	120_S	0.642	0.12
34_Y	63_Q	0.635	0.12
11_G	100_T	0.634	0.12
54_D	104_E	0.632	0.12
125_K	140_N	0.631	0.12
48_Q	150_E	0.627	0.12
113_V	153_I	0.626	0.12
138_M	151_L	0.625	0.12
60_S	63_Q	0.623	0.12
14_R	134_N	0.622	0.12
75_R	104_E	0.611	0.12
3_V	52_V	0.606	0.12
19_M	107_K	0.603	0.12
50_E	62_Y	0.599	0.12
8_K	102_F	0.599	0.12
26_S	30_F	0.595	0.12
55_L	58_Q	0.592	0.12
25_I	28_F	0.590	0.12
39_E	116_K	0.590	0.12
49_K	106_V	0.590	0.12
80_Q	157_L	0.589	0.12
6_H	25_I	0.579	0.11
52_V	77_L	0.575	0.11
99_K	110_I	0.573	0.11
19_M	130_R	0.568	0.11
59_I	147_T	0.566	0.11
9_K	97_P	0.564	0.11
44_L	109_D	0.563	0.11
80_Q	129_K	0.563	0.11
125_K	158_T	0.562	0.11
131_T	160_E	0.559	0.11
136_V	141_E	0.558	0.11
20_M	55_L	0.557	0.11
26_S	85_K	0.556	0.11
26_S	86_L	0.556	0.11
57_N	84_V	0.554	0.11
53_K	56_N	0.553	0.11
42_V	152_I	0.551	0.11
45_I	102_F	0.551	0.11
53_K	84_V	0.549	0.11
1_M	12_W	0.548	0.11
91_K	128_L	0.546	0.11
33_T	60_S	0.544	0.11
4_P	22_G	0.541	0.11
48_Q	142_K	0.539	0.11
12_W	159_V	0.538	0.11
27_W	113_V	0.536	0.11
81_S	156_R	0.535	0.11
19_M	26_S	0.533	0.11
5_Q	10_P	0.532	0.11
9_K	114_I	0.530	0.11
74_K	144_Y	0.529	0.11
27_W	105_H	0.529	0.11
111_S	122_Y	0.527	0.11
105_H	163_I	0.521	0.10
7_Y	108_D	0.518	0.10
20_M	58_Q	0.515	0.10
90_D	96_Q	0.514	0.10
116_K	142_K	0.511	0.10
76_K	119_E	0.509	0.10
83_S	106_V	0.509	0.10
74_K	110_I	0.507	0.10
58_Q	81_S	0.507	0.10
154_Y	160_E	0.506	0.10
32_F	98_D	0.506	0.10
6_H	127_L	0.504	0.10
107_K	151_L	0.504	0.10
27_W	155_T	0.503	0.10
62_Y	86_L	0.500	0.10

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3wuqA	1	0.521	51.8	0.945	Contact Map
3rvyA	3	0.2275	51.8	0.945	Contact Map
2uygA	4	0.2515	49.7	0.946	Contact Map
3effK	4	0.3952	45.3	0.947	Contact Map
3qnqA	2	0.3114	34.4	0.951	Contact Map
3pjsK	4	0.3952	32.8	0.951	Contact Map
4bgnA	3	0.2515	26	0.954	Contact Map
4rh7A	1	0.9281	19.2	0.957	Contact Map
2l5gB	1	0.2515	16.3	0.958	Contact Map
4n0aH	1	0.497	14.8	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.