MOAB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MOAB - Molybdenum cofactor biosynthesis protein B

UniProt:	O34457	Sequences: MSVQEHKQEAPDIVRCKVITVSDTRTDETDKSGKLMISFLEEAGHHIAAYEIVKDEKDALQRSVLAGCMDEQTDAVLLNGGTGIADRDVTIEAITPLFSKELPGFGEIFRMLSYTEDIGSAAIMSRATAGVIQHTAVFSTPGSSGAVKLAMNKLIIPELAHVVREIRKDK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	170 (142)
Sequences:	7887 (5087)
Seq/√Len:	426.9

ECOLI - MOAB MOG MOEA
BACSU - MOAB MOEA
HALSA - Q9HP37 Q9HST2 Q9HST3
SULSO - Q981C6 Q97W71 Q7LXN4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_K	73_T	3.705	1.00
61_Q	96_P	3.576	1.00
40_L	45_H	3.265	1.00
95_T	101_E	2.271	1.00
57_K	96_P	2.196	1.00
107_E	110_R	2.124	1.00
57_K	61_Q	2.091	1.00
48_A	73_T	2.032	1.00
35_L	148_K	1.958	1.00
23_D	87_R	1.876	1.00
15_R	46_H	1.851	1.00
16_C	40_L	1.849	1.00
54_K	59_A	1.827	1.00
39_F	152_N	1.826	1.00
51_E	63_S	1.822	1.00
61_Q	65_L	1.818	1.00
138_F	155_I	1.816	1.00
37_I	41_E	1.798	1.00
57_K	93_A	1.790	1.00
94_I	139_S	1.771	1.00
56_E	59_A	1.768	1.00
18_V	37_I	1.742	1.00
63_S	66_A	1.708	1.00
17_K	67_G	1.688	1.00
19_I	67_G	1.664	1.00
43_A	151_M	1.641	1.00
65_L	97_L	1.606	1.00
43_A	156_I	1.603	1.00
57_K	92_E	1.602	1.00
156_I	160_A	1.596	1.00
84_I	102_L	1.561	1.00
151_M	155_I	1.525	1.00
61_Q	97_L	1.525	1.00
15_R	48_A	1.512	1.00
101_E	125_S	1.485	1.00
53_V	63_S	1.428	1.00
13_I	46_H	1.420	1.00
36_M	151_M	1.390	1.00
68_C	135_T	1.376	1.00
110_R	154_L	1.362	1.00
32_S	79_N	1.357	1.00
94_I	137_V	1.346	1.00
76_V	135_T	1.332	1.00
75_A	159_L	1.309	1.00
37_I	50_Y	1.299	1.00
31_K	144_S	1.272	1.00
63_S	67_G	1.216	1.00
108_I	154_L	1.209	1.00
138_F	158_E	1.204	1.00
20_T	79_N	1.194	1.00
21_V	53_V	1.185	1.00
108_I	111_M	1.178	1.00
145_G	149_L	1.176	1.00
40_L	47_I	1.162	1.00
39_F	151_M	1.144	1.00
122_A	139_S	1.127	1.00
19_I	63_S	1.121	1.00
35_L	144_S	1.116	1.00
66_A	72_Q	1.116	1.00
24_T	28_E	1.114	1.00
59_A	63_S	1.113	1.00
99_S	133_Q	1.111	1.00
58_D	61_Q	1.103	1.00
58_D	62_R	1.098	1.00
21_V	60_L	1.091	1.00
40_L	151_M	1.084	1.00
62_R	66_A	1.081	1.00
152_N	156_I	1.077	1.00
59_A	62_R	1.075	1.00
51_E	66_A	1.062	1.00
78_L	137_V	1.047	1.00
35_L	39_F	1.044	1.00
92_E	95_T	1.043	1.00
77_L	140_T	1.036	1.00
103_P	125_S	1.035	1.00
17_K	50_Y	1.033	1.00
140_T	150_A	1.026	1.00
57_K	89_V	1.017	1.00
81_G	90_T	1.013	1.00
38_S	42_E	1.008	1.00
34_K	38_S	1.005	1.00
30_D	33_G	0.998	1.00
61_Q	93_A	0.989	1.00
35_L	147_V	0.967	1.00
39_F	43_A	0.963	1.00
19_I	53_V	0.960	1.00
23_D	54_K	0.952	1.00
20_T	33_G	0.950	1.00
109_F	150_A	0.947	1.00
75_A	138_F	0.934	1.00
160_A	165_E	0.926	1.00
14_V	45_H	0.925	1.00
26_T	29_T	0.908	1.00
35_L	38_S	0.903	1.00
68_C	132_I	0.897	1.00
67_G	73_T	0.896	1.00
50_Y	73_T	0.896	1.00
91_I	95_T	0.895	1.00
110_R	150_A	0.891	1.00
18_V	47_I	0.889	1.00
33_G	49_A	0.882	1.00
77_L	155_I	0.882	1.00
50_Y	67_G	0.880	1.00
121_A	154_L	0.879	1.00
91_I	106_G	0.876	1.00
30_D	34_K	0.876	1.00
21_V	90_T	0.864	1.00
20_T	52_I	0.860	1.00
15_R	74_D	0.858	1.00
19_I	51_E	0.847	1.00
91_I	122_A	0.843	1.00
36_M	79_N	0.836	1.00
60_L	93_A	0.835	1.00
57_K	60_L	0.831	1.00
121_A	150_A	0.828	1.00
151_M	156_I	0.827	1.00
56_E	60_L	0.824	1.00
65_L	132_I	0.802	1.00
100_K	124_M	0.802	1.00
37_I	47_I	0.797	1.00
34_K	50_Y	0.793	1.00
64_V	94_I	0.786	1.00
100_K	126_R	0.767	1.00
106_G	110_R	0.766	1.00
132_I	137_V	0.766	1.00
18_V	40_L	0.760	1.00
16_C	45_H	0.757	1.00
114_Y	146_A	0.743	1.00
11_P	163_V	0.737	1.00
105_F	123_I	0.731	1.00
20_T	30_D	0.729	1.00
112_L	154_L	0.723	1.00
123_I	138_F	0.723	1.00
125_S	136_A	0.716	1.00
39_F	148_K	0.715	1.00
113_S	150_A	0.714	1.00
12_D	74_D	0.700	1.00
108_I	114_Y	0.694	1.00
78_L	90_T	0.693	1.00
21_V	24_T	0.692	1.00
15_R	73_T	0.691	1.00
60_L	89_V	0.691	1.00
65_L	133_Q	0.687	1.00
123_I	136_A	0.687	1.00
17_K	49_A	0.684	1.00
30_D	52_I	0.684	1.00
68_C	76_V	0.681	1.00
78_L	139_S	0.676	1.00
37_I	49_A	0.670	1.00
103_P	106_G	0.667	1.00
125_S	134_H	0.665	1.00
160_A	163_V	0.661	0.99
48_A	72_Q	0.660	0.99
141_P	146_A	0.659	0.99
106_G	122_A	0.658	0.99
75_A	136_A	0.656	0.99
136_A	162_V	0.653	0.99
64_V	78_L	0.652	0.99
50_Y	72_Q	0.645	0.99
16_C	75_A	0.644	0.99
111_M	114_Y	0.638	0.99
18_V	33_G	0.638	0.99
41_E	46_H	0.630	0.99
125_S	133_Q	0.621	0.99
126_R	133_Q	0.621	0.99
108_I	112_L	0.609	0.99
44_G	47_I	0.604	0.99
140_T	147_V	0.602	0.99
18_V	36_M	0.600	0.99
21_V	78_L	0.595	0.99
53_V	59_A	0.594	0.99
93_A	97_L	0.592	0.99
150_A	154_L	0.592	0.99
158_E	162_V	0.589	0.99
162_V	165_E	0.589	0.99
78_L	94_I	0.587	0.99
64_V	76_V	0.574	0.99
112_L	153_K	0.574	0.99
20_T	51_E	0.573	0.99
102_L	106_G	0.570	0.99
67_G	76_V	0.566	0.98
36_M	140_T	0.562	0.98
20_T	32_S	0.562	0.98
40_L	77_L	0.559	0.98
82_T	139_S	0.559	0.98
24_T	27_D	0.557	0.98
89_V	92_E	0.552	0.98
78_L	82_T	0.551	0.98
92_E	96_P	0.550	0.98
136_A	158_E	0.548	0.98
45_H	159_L	0.545	0.98
36_M	147_V	0.544	0.98
33_G	50_Y	0.537	0.98
82_T	90_T	0.533	0.98
101_E	106_G	0.532	0.98
144_S	148_K	0.531	0.98
60_L	64_V	0.530	0.98
126_R	135_T	0.526	0.97
66_A	71_E	0.526	0.97
27_D	50_Y	0.524	0.97
82_T	91_I	0.520	0.97
55_D	142_G	0.517	0.97
56_E	89_V	0.510	0.97
31_K	34_K	0.509	0.97
148_K	152_N	0.508	0.97
90_T	137_V	0.506	0.97
82_T	122_A	0.506	0.97
84_I	107_E	0.504	0.97
102_L	122_A	0.502	0.97
88_D	146_A	0.501	0.97
141_P	150_A	0.501	0.97
38_S	41_E	0.500	0.97
83_G	120_S	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pd0A	2	0.9412	100	0.203	Contact Map
1g8lA	2	0.9059	100	0.21	Contact Map
1uz5A	1	0.8765	100	0.215	Contact Map
1wu2A	2	0.8176	100	0.246	Contact Map
1jljA	3	0.8824	100	0.254	Contact Map
3rfqA	5	0.8882	100	0.256	Contact Map
1y5eA	4	0.9118	100	0.258	Contact Map
4lhbA	4	0.8765	100	0.273	Contact Map
3iwtA	4	0.8941	100	0.287	Contact Map
4xcwA	3	0.9235	100	0.29	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.