SPEH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SPEH - S-adenosylmethionine decarboxylase proenzyme

UniProt:	O34426	Sequences: METMGRHVISELWGCDFDKLNDMDFIEKTFVNAALKSGAEVREVAFHKFAPQGVSGVVIISESHLTIHSFPEHGYASIDVYTCGDLDPNVAADYIAEALHADTRENIEIPRGMGPVQIKQAQAKVL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	126 (111)
Sequences:	908 (580)
Seq/√Len:	55.0

BACSU - SPEH
SULSO - ARGDC SPEH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_D	100_H	3.158	1.00
26_I	99_L	2.996	1.00
34_A	41_V	2.937	1.00
46_F	56_G	2.898	1.00
14_G	102_D	2.652	1.00
44_V	58_V	2.574	1.00
55_S	60_I	2.506	1.00
89_N	108_E	2.313	1.00
29_T	95_I	2.233	1.00
27_E	31_V	2.224	1.00
77_S	81_Y	2.195	1.00
23_M	27_E	2.141	1.00
10_S	92_A	2.131	1.00
70_F	77_S	2.025	1.00
32_N	36_K	2.004	1.00
22_D	25_F	1.953	1.00
28_K	32_N	1.886	1.00
41_V	58_V	1.880	0.99
19_K	25_F	1.857	0.99
9_I	109_I	1.775	0.99
32_N	35_L	1.771	0.99
12_L	95_I	1.721	0.99
62_E	83_C	1.710	0.99
14_G	103_T	1.647	0.99
14_G	101_A	1.614	0.98
67_I	78_I	1.540	0.98
26_I	54_V	1.514	0.98
25_F	29_T	1.494	0.97
21_N	51_P	1.410	0.96
49_F	72_E	1.365	0.96
27_E	44_V	1.335	0.95
29_T	98_A	1.314	0.95
31_V	44_V	1.282	0.94
67_I	76_A	1.279	0.94
46_F	58_V	1.269	0.93
10_S	80_V	1.259	0.93
48_K	52_Q	1.232	0.92
26_I	67_I	1.225	0.92
30_F	65_L	1.218	0.92
89_N	93_D	1.199	0.91
13_W	103_T	1.175	0.90
5_G	63_S	1.150	0.89
72_E	83_C	1.140	0.89
23_M	54_V	1.132	0.89
93_D	96_A	1.107	0.88
55_S	66_T	1.098	0.87
23_M	48_K	1.093	0.87
4_M	73_H	1.091	0.87
7_H	79_D	1.082	0.86
34_A	58_V	1.058	0.85
46_F	57_V	1.044	0.84
96_A	104_R	1.032	0.84
40_E	62_E	1.026	0.83
38_G	87_D	1.013	0.83
105_E	109_I	0.959	0.79
11_E	52_Q	0.946	0.78
57_V	66_T	0.943	0.78
27_E	46_F	0.932	0.77
37_S	82_T	0.930	0.77
39_A	84_G	0.922	0.76
29_T	67_I	0.905	0.75
56_G	70_F	0.897	0.74
65_L	95_I	0.893	0.74
49_F	83_C	0.877	0.72
39_A	77_S	0.875	0.72
43_E	58_V	0.867	0.72
60_I	82_T	0.866	0.71
33_A	37_S	0.865	0.71
42_R	61_S	0.863	0.71
31_V	41_V	0.852	0.70
32_N	94_Y	0.851	0.70
8_V	106_N	0.850	0.70
19_K	100_H	0.849	0.70
32_N	69_S	0.821	0.67
33_A	84_G	0.819	0.67
23_M	46_F	0.809	0.66
23_M	55_S	0.794	0.65
32_N	98_A	0.793	0.65
104_R	110_P	0.792	0.65
10_S	95_I	0.775	0.63
15_C	59_I	0.769	0.62
15_C	101_A	0.767	0.62
18_D	97_E	0.761	0.61
11_E	45_A	0.761	0.61
4_M	42_R	0.760	0.61
8_V	12_L	0.758	0.61
24_D	97_E	0.756	0.61
47_H	61_S	0.752	0.61
34_A	65_L	0.748	0.60
51_P	71_P	0.746	0.60
51_P	82_T	0.743	0.60
12_L	104_R	0.738	0.59
12_L	105_E	0.730	0.58
26_I	78_I	0.727	0.58
34_A	76_A	0.726	0.58
28_K	90_V	0.723	0.58
107_I	110_P	0.722	0.57
25_F	100_H	0.718	0.57
18_D	21_N	0.708	0.56
105_E	113_M	0.705	0.56
8_V	92_A	0.698	0.55
4_M	81_Y	0.684	0.53
33_A	94_Y	0.681	0.53
65_L	82_T	0.674	0.52
36_K	90_V	0.670	0.52
13_W	92_A	0.668	0.52
82_T	86_L	0.663	0.51
26_I	56_G	0.663	0.51
12_L	96_A	0.658	0.51
11_E	112_G	0.651	0.50
31_V	58_V	0.646	0.49
104_R	107_I	0.644	0.49
53_G	69_S	0.642	0.49
79_D	111_R	0.639	0.49
19_K	29_T	0.632	0.48
78_I	101_A	0.632	0.48
28_K	103_T	0.629	0.47
70_F	73_H	0.628	0.47
25_F	104_R	0.627	0.47
40_E	87_D	0.624	0.47
69_S	72_E	0.618	0.46
11_E	107_I	0.606	0.45
21_N	52_Q	0.606	0.45
80_V	96_A	0.602	0.45
57_V	70_F	0.599	0.44
44_V	87_D	0.595	0.44
35_L	93_D	0.592	0.44
11_E	48_K	0.591	0.43
65_L	86_L	0.588	0.43
4_M	70_F	0.588	0.43
50_A	102_D	0.587	0.43
31_V	35_L	0.587	0.43
21_N	48_K	0.584	0.43
49_F	62_E	0.582	0.42
16_D	29_T	0.582	0.42
81_Y	96_A	0.582	0.42
78_I	81_Y	0.573	0.42
4_M	58_V	0.572	0.41
65_L	77_S	0.571	0.41
93_D	97_E	0.570	0.41
22_D	35_L	0.569	0.41
8_V	94_Y	0.566	0.41
71_P	112_G	0.563	0.40
84_G	88_P	0.559	0.40
81_Y	95_I	0.554	0.40
92_A	101_A	0.551	0.39
13_W	105_E	0.546	0.39
56_G	67_I	0.544	0.39
19_K	22_D	0.542	0.38
6_R	114_G	0.540	0.38
56_G	112_G	0.535	0.38
36_K	97_E	0.534	0.38
39_A	81_Y	0.533	0.37
55_S	70_F	0.531	0.37
33_A	39_A	0.528	0.37
38_G	90_V	0.523	0.36
76_A	101_A	0.521	0.36
105_E	110_P	0.519	0.36
35_L	46_F	0.518	0.36
90_V	93_D	0.513	0.35
53_G	62_E	0.513	0.35
28_K	108_E	0.511	0.35
47_H	54_V	0.507	0.35
35_L	40_E	0.505	0.35
41_V	46_F	0.505	0.35
25_F	98_A	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2iiiA	2	0.9365	100	0.128	Contact Map
1vr7A	2	0.9444	100	0.134	Contact Map
1mhmA	1	0.9524	95.1	0.862	Contact Map
1jl0A	2	0.9206	88.3	0.888	Contact Map
3c6kA	2	0.8968	44.2	0.921	Contact Map
5c4iC	2	0.9286	23.1	0.931	Contact Map
1z84A	2	0.7778	16.7	0.936	Contact Map
1q6zA	4	0.381	14.3	0.938	Contact Map
2od0A	2	0.3095	10.5	0.941	Contact Map
2wnyA	1	0.4524	8.2	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.