CWLK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CWLK - Peptidoglycan L-alanyl-D-glutamate endopeptidase CwlK

UniProt:	O34360	Sequences: MNLPAKTFVILCILFLLDLCFSYIRHEWHSQNALQDMPVPSDLHPIVKQNADALKAAAANKGIDVVITEGFRSFKEQDELYKQGRTKKGNIVTYARGGESYHNYGLAIDFALQKKDGSIIWDMEYDGNQNGKSDWLEVVEIAKTLGFEWGGDWKRFKDYPHLEMIPN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	167 (135)
Sequences:	263 (194)
Seq/√Len:	16.7

BACSU - CWLK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
148_E	163_E	6.474	1.00
143_K	152_D	4.894	1.00
69_E	76_E	4.194	1.00
150_G	158_D	3.383	0.99
63_I	128_N	3.318	0.99
101_Y	106_L	2.741	0.97
78_D	97_G	2.578	0.96
91_I	152_D	2.390	0.94
134_D	137_E	2.236	0.92
58_A	95_A	2.182	0.91
141_I	144_T	2.122	0.89
34_L	37_M	1.936	0.84
110_F	162_L	1.842	0.81
78_D	160_P	1.762	0.78
106_L	159_Y	1.709	0.76
150_G	160_P	1.695	0.75
50_N	54_L	1.674	0.74
98_G	103_N	1.667	0.74
82_K	86_T	1.642	0.73
54_L	138_V	1.632	0.72
58_A	141_I	1.562	0.69
96_R	103_N	1.534	0.67
90_N	118_S	1.489	0.65
126_D	137_E	1.486	0.65
113_Q	163_E	1.483	0.65
81_Y	85_R	1.479	0.64
136_L	139_V	1.479	0.64
94_Y	162_L	1.475	0.64
44_H	106_L	1.439	0.62
37_M	52_D	1.391	0.59
66_V	119_I	1.386	0.59
142_A	145_L	1.360	0.58
126_D	134_D	1.331	0.56
139_V	142_A	1.321	0.55
83_Q	89_G	1.296	0.54
110_F	139_V	1.282	0.53
123_M	139_V	1.273	0.53
54_L	65_V	1.251	0.51
61_K	66_V	1.243	0.51
61_K	141_I	1.236	0.50
101_Y	163_E	1.227	0.50
41_S	75_K	1.225	0.50
38_P	60_N	1.202	0.48
80_L	93_T	1.194	0.48
41_S	48_K	1.189	0.48
54_L	145_L	1.188	0.48
79_E	114_K	1.160	0.46
54_L	112_L	1.149	0.45
61_K	88_K	1.125	0.44
79_E	83_Q	1.099	0.42
42_D	51_A	1.070	0.41
133_S	136_L	1.054	0.40
76_E	94_Y	1.027	0.38
36_D	130_N	1.018	0.38
96_R	99_E	1.008	0.37
121_W	135_W	0.999	0.37
43_L	134_D	0.992	0.36
111_A	142_A	0.988	0.36
63_I	138_V	0.981	0.36
39_V	59_A	0.980	0.36
63_I	141_I	0.979	0.36
120_I	127_G	0.978	0.36
77_Q	80_L	0.971	0.35
55_K	69_E	0.968	0.35
121_W	142_A	0.957	0.34
139_V	165_I	0.949	0.34
51_A	108_I	0.947	0.34
111_A	121_W	0.944	0.34
123_M	159_Y	0.943	0.34
81_Y	146_G	0.941	0.34
64_D	113_Q	0.935	0.33
91_I	138_V	0.931	0.33
87_K	104_Y	0.929	0.33
149_W	152_D	0.928	0.33
58_A	71_F	0.917	0.32
67_I	117_G	0.915	0.32
82_K	97_G	0.913	0.32
54_L	134_D	0.908	0.32
154_K	157_K	0.899	0.31
77_Q	100_S	0.894	0.31
128_N	137_E	0.893	0.31
110_F	136_L	0.884	0.31
108_I	115_K	0.883	0.31
35_Q	39_V	0.864	0.30
95_A	99_E	0.862	0.30
63_I	130_N	0.860	0.29
36_D	39_V	0.859	0.29
34_L	38_P	0.855	0.29
55_K	70_G	0.855	0.29
133_S	140_E	0.854	0.29
81_Y	84_G	0.853	0.29
40_P	58_A	0.838	0.28
127_G	163_E	0.836	0.28
112_L	135_W	0.834	0.28
101_Y	159_Y	0.832	0.28
37_M	94_Y	0.830	0.28
36_D	70_G	0.820	0.28
128_N	147_F	0.813	0.27
35_Q	75_K	0.809	0.27
78_D	86_T	0.798	0.27
40_P	71_F	0.797	0.26
75_K	79_E	0.788	0.26
108_I	163_E	0.782	0.26
67_I	73_S	0.782	0.26
30_S	34_L	0.774	0.25
73_S	106_L	0.773	0.25
71_F	157_K	0.772	0.25
36_D	154_K	0.767	0.25
44_H	104_Y	0.767	0.25
85_R	93_T	0.760	0.25
112_L	121_W	0.760	0.25
131_G	137_E	0.756	0.25
110_F	145_L	0.753	0.24
135_W	138_V	0.742	0.24
97_G	104_Y	0.741	0.24
90_N	114_K	0.738	0.24
73_S	82_K	0.727	0.23
88_K	94_Y	0.713	0.23
42_D	60_N	0.713	0.23
42_D	118_S	0.708	0.23
55_K	132_K	0.705	0.22
66_V	113_Q	0.701	0.22
84_G	149_W	0.699	0.22
93_T	100_S	0.691	0.22
98_G	135_W	0.688	0.22
35_Q	148_E	0.686	0.22
108_I	147_F	0.681	0.21
156_F	162_L	0.679	0.21
138_V	143_K	0.678	0.21
96_R	144_T	0.678	0.21
43_L	78_D	0.676	0.21
106_L	163_E	0.672	0.21
38_P	133_S	0.671	0.21
47_V	147_F	0.669	0.21
68_T	134_D	0.669	0.21
41_S	155_R	0.663	0.21
127_G	164_M	0.660	0.21
61_K	144_T	0.659	0.21
114_K	118_S	0.659	0.21
33_A	155_R	0.658	0.21
32_N	70_G	0.657	0.21
126_D	130_N	0.652	0.20
63_I	103_N	0.651	0.20
121_W	156_F	0.650	0.20
86_T	162_L	0.642	0.20
59_A	155_R	0.640	0.20
32_N	36_D	0.637	0.20
131_G	134_D	0.636	0.20
112_L	120_I	0.634	0.20
118_S	148_E	0.633	0.20
94_Y	99_E	0.630	0.19
59_A	64_D	0.628	0.19
32_N	39_V	0.627	0.19
55_K	58_A	0.626	0.19
44_H	108_I	0.624	0.19
75_K	96_R	0.624	0.19
69_E	73_S	0.613	0.19
61_K	118_S	0.611	0.19
121_W	157_K	0.607	0.19
52_D	164_M	0.607	0.19
30_S	37_M	0.606	0.19
110_F	135_W	0.605	0.19
81_Y	96_R	0.601	0.18
112_L	139_V	0.600	0.18
39_V	82_K	0.595	0.18
101_Y	111_A	0.592	0.18
39_V	71_F	0.590	0.18
80_L	133_S	0.588	0.18
37_M	46_I	0.588	0.18
56_A	64_D	0.586	0.18
33_A	40_P	0.585	0.18
98_G	156_F	0.582	0.18
51_A	88_K	0.582	0.18
48_K	148_E	0.581	0.18
34_L	144_T	0.576	0.18
56_A	124_E	0.575	0.18
35_Q	164_M	0.574	0.17
74_F	148_E	0.573	0.17
65_V	114_K	0.571	0.17
97_G	103_N	0.570	0.17
68_T	119_I	0.569	0.17
57_A	144_T	0.565	0.17
103_N	135_W	0.550	0.17
132_K	154_K	0.549	0.17
83_Q	90_N	0.543	0.16
71_F	106_L	0.540	0.16
30_S	64_D	0.538	0.16
49_Q	57_A	0.538	0.16
112_L	134_D	0.537	0.16
50_N	145_L	0.533	0.16
88_K	144_T	0.528	0.16
40_P	148_E	0.522	0.16
124_E	154_K	0.521	0.16
31_Q	34_L	0.520	0.16
48_K	52_D	0.516	0.16
79_E	108_I	0.503	0.15
123_M	136_L	0.503	0.15
72_R	102_H	0.500	0.15
72_R	107_A	0.500	0.15
102_H	107_A	0.500	0.15
102_H	109_D	0.500	0.15
72_R	109_D	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2mxzA	1	0.7485	100	0.488	Contact Map
2vo9A	1	0.8024	100	0.517	Contact Map
4ox3A	1	0.9641	99.4	0.773	Contact Map
4mphA	2	0.8982	99.4	0.774	Contact Map
4muqA	1	0.9281	99.3	0.777	Contact Map
4nt9B	3	0.8623	99.3	0.777	Contact Map
4murA	2	0.8982	99.3	0.78	Contact Map
1r44A	1	0.9341	98.1	0.856	Contact Map
2ibgE	1	0.6707	97.7	0.869	Contact Map
3k7iB	1	0.7844	97.4	0.876	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0089 seconds.