YOQJ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOQJ - Uncharacterized SPBc2 prophage-derived protein YoqJ

UniProt:	O34359	Sequences: MKNPTMLKLKDKLLAVIEELITKENKYRFITGGALGTDQAACWCVHILKKKHPHIKNIIATPFKEQDKVWSADQKMWYKRMLNVADEIINVEELDKYKVSGEKPGEFSPAKMQKRNEYMIDHSEAIVAVYDGSKSGTRNCLNYAKKTYLGHQLWRLHPDFNFELDITYFVG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (144)
Sequences:	609 (492)
Seq/√Len:	41.0

BACSU - YOQJ YPSA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_T	129_V	2.923	1.00
45_V	57_N	2.880	1.00
42_C	81_M	2.765	1.00
26_K	29_F	2.619	1.00
49_K	86_D	2.579	1.00
144_A	153_L	2.559	1.00
66_Q	78_Y	2.475	1.00
63_F	112_M	2.356	1.00
42_C	57_N	2.252	1.00
65_E	68_K	2.241	1.00
20_L	127_V	2.191	1.00
92_E	114_K	2.148	0.99
61_T	90_N	2.022	0.99
35_L	70_W	2.020	0.99
29_F	45_V	1.992	0.99
33_G	59_I	1.976	0.99
60_A	119_M	1.974	0.99
14_L	18_E	1.973	0.99
135_S	139_N	1.949	0.99
126_I	144_A	1.938	0.99
123_S	151_H	1.937	0.99
14_L	44_C	1.924	0.99
71_S	74_Q	1.886	0.98
20_L	154_W	1.818	0.98
105_G	108_S	1.802	0.98
134_K	138_R	1.793	0.98
59_I	82_L	1.788	0.98
75_K	79_K	1.776	0.98
29_F	55_I	1.751	0.98
10_K	44_C	1.732	0.97
17_I	29_F	1.692	0.97
72_A	75_K	1.685	0.97
118_Y	122_H	1.645	0.96
138_R	142_N	1.570	0.95
39_Q	81_M	1.556	0.95
30_I	60_A	1.533	0.95
32_G	115_R	1.509	0.94
115_R	136_G	1.490	0.94
14_L	47_I	1.435	0.92
10_K	43_W	1.422	0.92
31_T	42_C	1.389	0.91
16_V	154_W	1.353	0.90
32_G	119_M	1.317	0.89
30_I	123_S	1.316	0.89
60_A	91_V	1.301	0.88
67_D	78_Y	1.290	0.88
64_K	105_G	1.287	0.87
43_W	77_W	1.275	0.87
13_L	41_A	1.256	0.86
61_T	78_Y	1.225	0.85
66_Q	116_N	1.224	0.85
9_L	12_K	1.201	0.84
18_E	48_L	1.197	0.83
16_V	127_V	1.188	0.83
38_D	115_R	1.180	0.82
6_M	77_W	1.167	0.82
117_E	121_D	1.156	0.81
46_H	57_N	1.133	0.80
46_H	49_K	1.101	0.78
59_I	85_A	1.100	0.78
58_I	89_I	1.091	0.77
35_L	74_Q	1.088	0.77
116_N	140_C	1.078	0.76
107_F	111_K	1.076	0.76
120_I	143_Y	1.061	0.75
31_T	59_I	1.058	0.75
30_I	122_H	1.050	0.74
126_I	140_C	1.035	0.73
28_R	58_I	1.031	0.73
32_G	136_G	1.030	0.73
116_N	136_G	1.029	0.73
118_Y	130_Y	1.026	0.73
82_L	116_N	1.020	0.72
26_K	125_A	1.005	0.71
30_I	119_M	1.002	0.71
28_R	118_Y	0.997	0.70
124_E	151_H	0.994	0.70
121_D	147_T	0.984	0.69
21_I	24_E	0.976	0.69
115_R	140_C	0.969	0.68
119_M	122_H	0.940	0.66
18_E	51_K	0.939	0.66
61_T	88_I	0.930	0.65
30_I	124_E	0.922	0.64
42_C	85_A	0.919	0.64
119_M	140_C	0.916	0.64
21_I	27_Y	0.910	0.63
66_Q	136_G	0.908	0.63
62_P	85_A	0.901	0.63
128_A	141_L	0.901	0.63
78_Y	82_L	0.899	0.62
57_N	85_A	0.892	0.62
112_M	138_R	0.888	0.61
141_L	145_K	0.885	0.61
8_K	11_D	0.884	0.61
74_Q	158_P	0.873	0.60
80_R	84_V	0.864	0.59
21_I	54_H	0.861	0.59
112_M	140_C	0.840	0.57
18_E	21_I	0.834	0.57
28_R	56_K	0.831	0.56
32_G	62_P	0.824	0.56
32_G	38_D	0.821	0.55
70_W	75_K	0.813	0.55
52_H	55_I	0.809	0.54
67_D	75_K	0.798	0.53
117_E	143_Y	0.796	0.53
33_G	41_A	0.792	0.53
21_I	55_I	0.788	0.52
18_E	23_K	0.781	0.52
70_W	112_M	0.769	0.51
48_L	107_F	0.759	0.50
116_N	143_Y	0.759	0.50
140_C	144_A	0.757	0.49
53_P	134_K	0.754	0.49
42_C	59_I	0.753	0.49
71_S	158_P	0.749	0.49
34_A	115_R	0.741	0.48
80_R	83_N	0.741	0.48
67_D	115_R	0.734	0.47
35_L	71_S	0.731	0.47
28_R	87_E	0.729	0.47
145_K	149_L	0.729	0.47
129_V	156_L	0.728	0.47
13_L	83_N	0.713	0.45
21_I	145_K	0.711	0.45
126_I	130_Y	0.710	0.45
45_V	85_A	0.710	0.45
31_T	39_Q	0.707	0.45
30_I	58_I	0.706	0.45
86_D	107_F	0.705	0.45
37_T	155_R	0.701	0.44
42_C	45_V	0.698	0.44
15_A	54_H	0.698	0.44
21_I	48_L	0.692	0.43
65_E	106_E	0.688	0.43
141_L	155_R	0.687	0.43
27_Y	56_K	0.686	0.43
128_A	132_G	0.679	0.42
135_S	138_R	0.671	0.42
45_V	56_K	0.670	0.41
105_G	127_V	0.667	0.41
60_A	118_Y	0.664	0.41
46_H	82_L	0.655	0.40
23_K	55_I	0.650	0.40
34_A	136_G	0.646	0.39
132_G	155_R	0.643	0.39
29_F	41_A	0.640	0.39
60_A	140_C	0.638	0.39
21_I	26_K	0.637	0.39
76_M	80_R	0.636	0.38
56_K	75_K	0.634	0.38
42_C	46_H	0.631	0.38
30_I	127_V	0.628	0.38
76_M	149_L	0.621	0.37
92_E	105_G	0.620	0.37
79_K	123_S	0.619	0.37
112_M	116_N	0.617	0.37
34_A	137_T	0.616	0.37
18_E	52_H	0.615	0.37
142_N	146_K	0.607	0.36
43_W	81_M	0.606	0.36
39_Q	112_M	0.602	0.35
25_N	88_I	0.601	0.35
14_L	48_L	0.600	0.35
16_V	19_E	0.597	0.35
38_D	58_I	0.596	0.35
125_A	154_W	0.591	0.35
46_H	84_V	0.587	0.34
84_V	149_L	0.581	0.34
46_H	81_M	0.580	0.34
11_D	15_A	0.579	0.34
157_H	160_F	0.577	0.33
6_M	149_L	0.575	0.33
17_I	45_V	0.573	0.33
10_K	40_A	0.572	0.33
50_K	150_G	0.569	0.33
92_E	123_S	0.567	0.33
142_N	145_K	0.564	0.32
6_M	10_K	0.564	0.32
123_S	126_I	0.561	0.32
126_I	153_L	0.557	0.32
57_N	81_M	0.557	0.32
66_Q	115_R	0.557	0.32
14_L	51_K	0.556	0.32
65_E	113_Q	0.555	0.32
13_L	152_Q	0.553	0.31
39_Q	116_N	0.551	0.31
9_L	156_L	0.551	0.31
115_R	119_M	0.548	0.31
37_T	158_P	0.545	0.31
85_A	135_S	0.545	0.31
58_I	87_E	0.543	0.31
39_Q	77_W	0.543	0.31
116_N	159_D	0.541	0.30
5_T	140_C	0.539	0.30
91_V	105_G	0.539	0.30
49_K	116_N	0.534	0.30
81_M	85_A	0.534	0.30
121_D	143_Y	0.527	0.29
21_I	113_Q	0.526	0.29
33_G	132_G	0.524	0.29
55_I	83_N	0.522	0.29
49_K	84_V	0.521	0.29
137_T	140_C	0.521	0.29
35_L	118_Y	0.519	0.29
92_E	118_Y	0.518	0.29
109_P	113_Q	0.518	0.29
14_L	109_P	0.517	0.29
11_D	14_L	0.516	0.29
24_E	83_N	0.512	0.28
45_V	55_I	0.510	0.28
60_A	143_Y	0.510	0.28
43_W	46_H	0.510	0.28
44_C	50_K	0.503	0.28
28_R	111_K	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2nx2A	1	0.8947	100	0.372	Contact Map
4ljrA	2	0.8304	99.7	0.702	Contact Map
3imkA	1	0.7018	99.7	0.705	Contact Map
3uqzA	2	0.8596	99.6	0.722	Contact Map
3majA	2	0.8538	99.4	0.756	Contact Map
1rcuA	3	0.7368	98.6	0.824	Contact Map
2iz6A	4	0.6959	98.2	0.839	Contact Map
3quaA	2	0.7719	97.9	0.853	Contact Map
1t35A	5	0.7544	97.6	0.863	Contact Map
3sbxA	2	0.7661	97.5	0.864	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.