YJOA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJOA - Uncharacterized protein YjoA

UniProt:	O34334	Sequences: MCQSNQIVSHFLSHRNVTNELAEKISKDHYSYKPAETSMSAEELVKHILTSFHLFANVIKEGNASPFQNKQEETETDLNVLAKTYTEKTVAILEQLTEEQLDREIDLTSAFGRKVTGRALLQLAMEHEIHHKGNLFVYVREMGHTELPFYQQRM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (140)
Sequences:	668 (566)
Seq/√Len:	47.8

BACSU - YJOA YRDA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
100_Q	103_R	3.771	1.00
76_T	80_V	3.551	1.00
104_E	114_K	3.373	1.00
106_D	114_K	3.229	1.00
74_T	77_D	2.718	1.00
12_L	90_V	2.657	1.00
23_E	83_K	2.576	1.00
80_V	84_T	2.535	1.00
18_T	132_K	2.351	1.00
87_E	91_A	2.278	1.00
97_T	100_Q	2.250	1.00
23_E	79_N	2.195	1.00
19_N	23_E	2.109	1.00
27_K	76_T	2.063	1.00
33_K	40_S	2.051	1.00
79_N	83_K	2.017	0.99
133_G	136_F	1.959	0.99
10_H	122_Q	1.942	0.99
14_H	126_E	1.885	0.99
104_E	116_T	1.749	0.99
19_N	83_K	1.689	0.98
30_Y	78_L	1.684	0.98
116_T	119_A	1.648	0.98
47_H	127_H	1.647	0.98
8_V	94_E	1.628	0.98
30_Y	42_E	1.612	0.97
127_H	133_G	1.566	0.97
132_K	139_V	1.556	0.97
22_A	45_V	1.547	0.97
77_D	80_V	1.532	0.97
55_F	124_A	1.502	0.96
84_T	88_K	1.497	0.96
25_I	75_E	1.486	0.96
6_Q	118_R	1.448	0.95
58_V	64_A	1.440	0.95
32_Y	141_E	1.403	0.94
34_P	138_Y	1.381	0.94
91_A	94_E	1.371	0.94
40_S	43_E	1.368	0.93
107_L	120_L	1.347	0.93
115_V	120_L	1.347	0.93
49_L	52_F	1.324	0.92
36_E	143_G	1.317	0.92
5_N	9_S	1.295	0.91
30_Y	45_V	1.239	0.90
33_K	36_E	1.201	0.88
8_V	90_V	1.194	0.88
39_M	123_L	1.179	0.87
20_E	23_E	1.170	0.87
92_I	95_Q	1.165	0.86
22_A	82_A	1.165	0.86
18_T	130_H	1.154	0.86
32_Y	142_M	1.145	0.85
90_V	94_E	1.138	0.85
29_H	142_M	1.123	0.84
49_L	85_Y	1.117	0.84
19_N	79_N	1.109	0.84
56_A	60_K	1.093	0.83
35_A	38_S	1.089	0.82
25_I	41_A	1.085	0.82
45_V	135_L	1.055	0.80
15_R	128_E	1.055	0.80
26_S	75_E	1.039	0.79
27_K	75_E	1.016	0.78
21_L	133_G	1.007	0.77
127_H	136_F	1.007	0.77
41_A	44_L	1.004	0.77
86_T	128_E	1.002	0.77
44_L	77_D	0.989	0.76
33_K	82_A	0.981	0.75
115_V	119_A	0.973	0.75
33_K	141_E	0.971	0.75
81_L	84_T	0.970	0.74
41_A	75_E	0.965	0.74
31_S	91_A	0.955	0.73
80_V	97_T	0.947	0.73
40_S	47_H	0.930	0.71
72_E	77_D	0.928	0.71
130_H	137_V	0.927	0.71
55_F	123_L	0.926	0.71
41_A	135_L	0.924	0.71
26_S	29_H	0.917	0.70
11_F	38_S	0.913	0.70
22_A	49_L	0.912	0.70
21_L	139_V	0.908	0.69
30_Y	75_E	0.892	0.68
18_T	139_V	0.888	0.68
7_I	121_L	0.884	0.67
15_R	86_T	0.877	0.67
38_S	126_E	0.870	0.66
46_K	78_L	0.866	0.66
22_A	30_Y	0.863	0.65
104_E	107_L	0.862	0.65
137_V	141_E	0.858	0.65
14_H	17_V	0.853	0.65
130_H	134_N	0.837	0.63
35_A	141_E	0.835	0.63
54_L	111_F	0.833	0.63
24_K	146_E	0.830	0.62
5_N	81_L	0.828	0.62
9_S	16_N	0.814	0.61
44_L	134_N	0.809	0.60
9_S	119_A	0.805	0.60
25_I	30_Y	0.799	0.59
49_L	81_L	0.791	0.59
63_N	95_Q	0.781	0.58
51_S	54_L	0.780	0.58
51_S	59_I	0.779	0.58
33_K	37_T	0.773	0.57
126_E	129_I	0.771	0.57
91_A	95_Q	0.762	0.56
31_S	42_E	0.762	0.56
82_A	128_E	0.754	0.55
14_H	132_K	0.754	0.55
10_H	126_E	0.752	0.55
25_I	139_V	0.749	0.55
21_L	146_E	0.745	0.54
48_I	135_L	0.730	0.53
18_T	22_A	0.724	0.52
8_V	87_E	0.721	0.52
75_E	79_N	0.720	0.52
42_E	133_G	0.717	0.51
67_F	70_K	0.715	0.51
50_T	105_I	0.708	0.50
138_Y	141_E	0.702	0.50
77_D	81_L	0.700	0.50
34_P	135_L	0.692	0.49
105_I	117_G	0.690	0.49
8_V	91_A	0.688	0.48
14_H	45_V	0.683	0.48
73_E	80_V	0.680	0.48
96_L	100_Q	0.679	0.48
14_H	128_E	0.677	0.47
86_T	125_M	0.676	0.47
74_T	104_E	0.667	0.46
36_E	104_E	0.666	0.46
38_S	135_L	0.665	0.46
68_Q	100_Q	0.664	0.46
47_H	135_L	0.662	0.46
71_Q	121_L	0.660	0.46
75_E	146_E	0.657	0.45
33_K	138_Y	0.656	0.45
41_A	146_E	0.654	0.45
46_K	72_E	0.654	0.45
58_V	107_L	0.652	0.45
32_Y	138_Y	0.650	0.45
101_L	136_F	0.648	0.44
18_T	35_A	0.648	0.44
70_K	91_A	0.641	0.44
23_E	31_S	0.639	0.44
55_F	111_F	0.635	0.43
22_A	25_I	0.635	0.43
14_H	86_T	0.631	0.43
11_F	125_M	0.631	0.43
45_V	49_L	0.627	0.42
47_H	51_S	0.627	0.42
138_Y	142_M	0.621	0.42
6_Q	137_V	0.615	0.41
60_K	112_G	0.612	0.41
14_H	129_I	0.608	0.41
5_N	119_A	0.606	0.40
24_K	139_V	0.604	0.40
12_L	94_E	0.601	0.40
25_I	127_H	0.600	0.40
21_L	132_K	0.598	0.40
11_F	128_E	0.598	0.40
70_K	104_E	0.593	0.39
53_H	56_A	0.593	0.39
21_L	136_F	0.592	0.39
54_L	58_V	0.592	0.39
5_N	65_S	0.590	0.39
10_H	14_H	0.587	0.39
38_S	137_V	0.587	0.39
50_T	54_L	0.586	0.38
67_F	98_E	0.584	0.38
47_H	82_A	0.580	0.38
79_N	99_E	0.579	0.38
45_V	93_L	0.579	0.38
27_K	30_Y	0.573	0.37
53_H	92_I	0.573	0.37
131_H	134_N	0.571	0.37
65_S	80_V	0.568	0.37
30_Y	79_N	0.568	0.37
96_L	115_V	0.567	0.37
73_E	102_D	0.562	0.36
61_E	64_A	0.561	0.36
16_N	106_D	0.560	0.36
30_Y	55_F	0.557	0.36
57_N	98_E	0.556	0.36
24_K	93_L	0.553	0.35
98_E	118_R	0.551	0.35
38_S	146_E	0.543	0.34
73_E	84_T	0.543	0.34
21_L	143_G	0.537	0.34
132_K	136_F	0.536	0.34
30_Y	72_E	0.534	0.34
17_V	132_K	0.529	0.33
49_L	92_I	0.529	0.33
120_L	124_A	0.524	0.33
24_K	148_P	0.523	0.33
17_V	38_S	0.517	0.32
138_Y	148_P	0.515	0.32
21_L	127_H	0.508	0.31
50_T	81_L	0.507	0.31
50_T	71_Q	0.507	0.31
105_I	120_L	0.505	0.31
67_F	111_F	0.504	0.31
14_H	44_L	0.503	0.31
76_T	99_E	0.502	0.31
7_I	11_F	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2p1aA	2	0.9286	99.9	0.481	Contact Map
3dkaA	2	0.961	99.9	0.483	Contact Map
3gorA	2	0.9935	99.9	0.499	Contact Map
2hkvA	2	0.9416	99.9	0.523	Contact Map
2f22A	2	0.9091	99.9	0.539	Contact Map
3di5A	1	0.9545	99.9	0.544	Contact Map
2qe9A	2	0.9935	99.8	0.564	Contact Map
2qnlA	2	0.9026	99.8	0.576	Contact Map
3cexA	2	0.9221	99.8	0.591	Contact Map
1rxqA	3	0.9351	99.8	0.595	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.