YVLA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVLA - Uncharacterized protein YvlA

UniProt:	O34322	Sequences: MNRNQAIIASLCYFSVFIAPIIVPIVAYFVVNEKETKRHAIRSLISHIVPFVGWLFLFIALLGGAVAIDGDSLLPVFVIIGGAVIYFLVVIGIIIWNVIQGIKVLRAA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	108 (99)
Sequences:	182 (149)
Seq/√Len:	15.0

BACSU - YVLA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_V	27_A	4.485	1.00
12_C	43_S	3.397	0.99
12_C	27_A	2.570	0.95
37_K	96_W	2.448	0.93
19_A	44_L	2.419	0.93
30_V	52_V	2.303	0.91
96_W	99_I	2.052	0.84
9_A	104_V	2.011	0.83
91_I	103_K	1.967	0.82
4_N	62_L	1.745	0.73
52_V	81_G	1.712	0.72
14_F	101_G	1.695	0.71
46_S	93_I	1.649	0.69
14_F	46_S	1.613	0.67
14_F	39_H	1.530	0.63
74_L	102_I	1.397	0.55
36_T	50_P	1.394	0.55
99_I	103_K	1.364	0.54
77_F	102_I	1.331	0.52
10_S	17_F	1.319	0.51
100_Q	103_K	1.310	0.51
22_I	99_I	1.309	0.51
29_F	96_W	1.275	0.49
37_K	46_S	1.251	0.47
16_V	81_G	1.246	0.47
10_S	105_L	1.239	0.47
56_F	99_I	1.216	0.45
16_V	48_I	1.213	0.45
9_A	39_H	1.210	0.45
26_V	30_V	1.203	0.45
17_F	98_V	1.200	0.44
80_I	98_V	1.196	0.44
21_I	52_V	1.188	0.44
86_Y	95_I	1.175	0.43
21_I	51_F	1.167	0.43
58_F	74_L	1.165	0.43
61_L	102_I	1.163	0.42
25_I	79_I	1.162	0.42
85_I	104_V	1.151	0.42
16_V	94_I	1.147	0.42
46_S	96_W	1.146	0.41
84_V	88_L	1.137	0.41
40_A	80_I	1.132	0.41
8_I	98_V	1.123	0.40
22_I	58_F	1.100	0.39
22_I	73_L	1.089	0.38
11_L	18_I	1.065	0.37
44_L	88_L	1.064	0.37
62_L	69_D	1.059	0.37
26_V	60_A	1.058	0.37
22_I	49_V	1.055	0.37
58_F	63_G	1.024	0.35
65_A	76_V	1.000	0.34
25_I	91_I	0.990	0.33
54_W	90_V	0.989	0.33
11_L	105_L	0.984	0.33
29_F	37_K	0.978	0.33
80_I	87_F	0.974	0.33
9_A	14_F	0.971	0.32
8_I	39_H	0.971	0.32
89_V	94_I	0.963	0.32
44_L	99_I	0.958	0.32
9_A	82_G	0.952	0.31
59_I	82_G	0.951	0.31
22_I	62_L	0.948	0.31
17_F	25_I	0.948	0.31
77_F	81_G	0.944	0.31
19_A	41_I	0.925	0.30
48_I	68_I	0.922	0.30
7_I	61_L	0.921	0.30
14_F	105_L	0.920	0.30
28_Y	96_W	0.916	0.30
8_I	62_L	0.907	0.29
42_R	104_V	0.901	0.29
39_H	97_N	0.888	0.28
38_R	95_I	0.888	0.28
6_A	105_L	0.884	0.28
9_A	42_R	0.878	0.28
62_L	84_V	0.865	0.27
37_K	99_I	0.859	0.27
63_G	67_A	0.854	0.27
6_A	16_V	0.844	0.26
73_L	84_V	0.843	0.26
50_P	96_W	0.836	0.26
22_I	101_G	0.833	0.26
58_F	67_A	0.825	0.26
26_V	102_I	0.823	0.26
14_F	21_I	0.800	0.25
42_R	83_A	0.800	0.25
14_F	52_V	0.789	0.24
46_S	98_V	0.771	0.23
49_V	86_Y	0.769	0.23
74_L	80_I	0.767	0.23
35_E	66_V	0.760	0.23
83_A	102_I	0.750	0.23
48_I	82_G	0.742	0.22
12_C	21_I	0.741	0.22
46_S	99_I	0.724	0.22
55_L	102_I	0.718	0.21
6_A	94_I	0.713	0.21
24_P	97_N	0.698	0.21
31_V	86_Y	0.695	0.20
58_F	65_A	0.694	0.20
63_G	91_I	0.691	0.20
30_V	90_V	0.683	0.20
7_I	81_G	0.678	0.20
47_H	101_G	0.668	0.19
20_P	60_A	0.664	0.19
54_W	61_L	0.661	0.19
21_I	45_I	0.653	0.19
26_V	29_F	0.647	0.19
7_I	105_L	0.644	0.19
26_V	99_I	0.642	0.19
65_A	89_V	0.639	0.18
7_I	75_P	0.631	0.18
7_I	69_D	0.630	0.18
63_G	80_I	0.620	0.18
48_I	53_G	0.610	0.18
22_I	38_R	0.603	0.17
12_C	40_A	0.598	0.17
94_I	99_I	0.596	0.17
11_L	41_I	0.590	0.17
37_K	41_I	0.585	0.17
44_L	64_G	0.582	0.17
31_V	84_V	0.581	0.17
16_V	95_I	0.578	0.17
9_A	94_I	0.578	0.17
45_I	67_A	0.575	0.16
4_N	34_K	0.573	0.16
22_I	105_L	0.566	0.16
46_S	82_G	0.562	0.16
51_F	57_L	0.560	0.16
8_I	30_V	0.560	0.16
21_I	78_V	0.557	0.16
28_Y	43_S	0.548	0.16
35_E	50_P	0.546	0.16
18_I	88_L	0.541	0.15
31_V	42_R	0.540	0.15
22_I	41_I	0.538	0.15
17_F	95_I	0.534	0.15
10_S	39_H	0.526	0.15
65_A	102_I	0.523	0.15
20_P	43_S	0.520	0.15
35_E	38_R	0.520	0.15
14_F	93_I	0.519	0.15
62_L	72_S	0.509	0.14
44_L	97_N	0.503	0.14
18_I	24_P	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ev6A	3	0.6296	4.2	0.945	Contact Map
4p6vB	1	0.3611	3.4	0.947	Contact Map
1v54A	1	0.9444	2.7	0.95	Contact Map
3kpeB	1	0.1019	2.7	0.95	Contact Map
4lvpA	4	0.4722	2.5	0.951	Contact Map
4ak1A	5	0.2593	2.3	0.952	Contact Map
3ayfA	2	0.963	2.2	0.952	Contact Map
4ak2A	1	0.3241	2.2	0.952	Contact Map
2yevA	1	0.963	2.2	0.952	Contact Map
3s8fA	1	0.963	2.2	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.