YLOU - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLOU - Uncharacterized protein YloU

UniProt:	O34318	Sequences: MSIELRTKYGQIDISNEVIAMVAGGAAVDCYGIVGMASKNQIKDGLTEILRKENFSRGVQVRQEGEQIHIDMYIIVSYGTKISEVAHNVQTKVKYTVNQTIGLAVDSVNIYVQGVRVTNP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	120 (109)
Sequences:	1942 (1110)
Seq/√Len:	106.3

BACSU - YLOU YQHY

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_D	109_N	4.940	1.00
67_Q	104_A	3.089	1.00
74_I	89_V	2.942	1.00
70_I	97_V	2.329	1.00
22_V	100_T	2.259	1.00
76_V	82_I	2.236	1.00
67_Q	106_D	2.209	1.00
29_D	92_K	2.207	1.00
73_Y	111_Y	2.149	1.00
73_Y	113_Q	1.995	1.00
24_G	55_F	1.948	1.00
33_I	89_V	1.933	1.00
69_H	107_S	1.930	1.00
64_E	67_Q	1.909	1.00
105_V	108_V	1.848	1.00
44_D	48_E	1.828	1.00
64_E	69_H	1.760	1.00
27_A	36_M	1.692	1.00
34_V	116_R	1.636	1.00
44_D	50_L	1.634	1.00
72_M	93_V	1.535	1.00
66_E	106_D	1.509	1.00
80_T	85_V	1.484	1.00
64_E	106_D	1.462	1.00
94_K	98_N	1.459	1.00
88_N	91_T	1.448	1.00
23_A	70_I	1.440	1.00
76_V	85_V	1.384	1.00
62_R	69_H	1.382	1.00
82_I	112_V	1.370	1.00
59_V	72_M	1.360	1.00
84_E	88_N	1.332	0.99
43_K	47_T	1.323	0.99
31_Y	77_S	1.311	0.99
47_T	50_L	1.301	0.99
75_I	114_G	1.294	0.99
37_A	75_I	1.244	0.99
69_H	106_D	1.221	0.99
30_C	90_Q	1.208	0.99
26_A	96_T	1.199	0.99
23_A	97_V	1.168	0.99
98_N	104_A	1.153	0.98
20_A	61_V	1.136	0.98
81_K	84_E	1.133	0.98
31_Y	80_T	1.119	0.98
10_G	115_V	1.118	0.98
43_K	49_I	1.099	0.98
27_A	89_V	1.097	0.98
96_T	100_T	1.091	0.98
33_I	74_I	1.088	0.98
45_G	50_L	1.056	0.97
84_E	87_H	1.056	0.97
33_I	60_Q	1.053	0.97
44_D	47_T	1.038	0.97
43_K	48_E	1.034	0.97
90_Q	94_K	1.008	0.96
35_G	75_I	1.006	0.96
34_V	117_V	0.998	0.96
61_V	70_I	0.982	0.96
18_V	99_Q	0.974	0.96
12_I	98_N	0.967	0.95
64_E	112_V	0.959	0.95
74_I	112_V	0.952	0.95
76_V	80_T	0.950	0.95
23_A	105_V	0.942	0.95
36_M	58_G	0.927	0.94
19_I	103_L	0.920	0.94
98_N	105_V	0.902	0.93
35_G	49_I	0.899	0.93
28_V	115_V	0.898	0.93
89_V	110_I	0.896	0.93
23_A	61_V	0.884	0.93
27_A	72_M	0.871	0.92
24_G	36_M	0.867	0.92
29_D	96_T	0.862	0.92
16_N	63_Q	0.858	0.92
64_E	107_S	0.847	0.91
20_A	56_S	0.843	0.91
45_G	48_E	0.827	0.90
15_S	60_Q	0.818	0.89
79_G	82_I	0.818	0.89
18_V	22_V	0.816	0.89
28_V	33_I	0.816	0.89
81_K	86_A	0.800	0.88
19_I	64_E	0.800	0.88
75_I	116_R	0.790	0.88
7_T	88_N	0.785	0.87
47_T	57_R	0.765	0.86
42_I	90_Q	0.757	0.86
14_I	82_I	0.757	0.86
19_I	68_I	0.757	0.86
61_V	68_I	0.750	0.85
86_A	112_V	0.740	0.84
10_G	110_I	0.738	0.84
31_Y	88_N	0.730	0.83
38_S	43_K	0.728	0.83
23_A	27_A	0.728	0.83
9_Y	12_I	0.723	0.83
33_I	86_A	0.722	0.83
77_S	80_T	0.717	0.82
102_G	115_V	0.697	0.80
22_V	103_L	0.688	0.80
34_V	85_V	0.679	0.79
71_D	111_Y	0.678	0.79
18_V	100_T	0.677	0.79
19_I	61_V	0.674	0.78
18_V	38_S	0.663	0.77
17_E	60_Q	0.649	0.76
22_V	31_Y	0.649	0.76
72_M	76_V	0.644	0.75
70_I	105_V	0.644	0.75
42_I	46_L	0.641	0.75
92_K	96_T	0.640	0.75
86_A	111_Y	0.635	0.74
22_V	101_I	0.635	0.74
17_E	54_N	0.634	0.74
13_D	19_I	0.634	0.74
15_S	18_V	0.633	0.74
24_G	28_V	0.632	0.74
60_Q	71_D	0.629	0.73
87_H	90_Q	0.626	0.73
30_C	92_K	0.624	0.73
21_M	51_R	0.623	0.73
43_K	50_L	0.623	0.73
93_V	97_V	0.622	0.72
46_L	50_L	0.614	0.71
27_A	91_T	0.610	0.71
88_N	95_Y	0.599	0.70
13_D	96_T	0.596	0.69
97_V	101_I	0.594	0.69
33_I	107_S	0.592	0.69
31_Y	83_S	0.592	0.69
12_I	90_Q	0.589	0.68
69_H	109_N	0.587	0.68
46_L	55_F	0.584	0.68
36_M	113_Q	0.578	0.67
31_Y	95_Y	0.572	0.66
47_T	102_G	0.568	0.66
60_Q	101_I	0.567	0.65
7_T	98_N	0.565	0.65
28_V	35_G	0.560	0.64
25_G	55_F	0.559	0.64
50_L	57_R	0.559	0.64
24_G	97_V	0.555	0.64
13_D	16_N	0.552	0.63
102_G	108_V	0.551	0.63
76_V	86_A	0.547	0.63
74_I	105_V	0.542	0.62
23_A	26_A	0.540	0.62
36_M	51_R	0.535	0.61
81_K	85_V	0.531	0.60
87_H	111_Y	0.531	0.60
95_Y	99_Q	0.530	0.60
97_V	105_V	0.528	0.60
33_I	72_M	0.527	0.60
79_G	103_L	0.525	0.60
61_V	64_E	0.525	0.60
32_G	80_T	0.522	0.59
14_I	110_I	0.512	0.58
29_D	99_Q	0.509	0.57
7_T	69_H	0.503	0.56
9_Y	62_R	0.502	0.56
20_A	58_G	0.500	0.56
67_Q	103_L	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4alzA	1	0.8583	26.6	0.915	Contact Map
4d2uA	3	0.5917	14.2	0.925	Contact Map
3ne5A	3	0.8083	13.6	0.925	Contact Map
2f2hA	4	0.5167	11.1	0.928	Contact Map
1wh9A	1	0.7	10.5	0.929	Contact Map
4k0jA	3	0.825	8.9	0.931	Contact Map
2dyjA	1	0.325	8.4	0.932	Contact Map
4w23D	1	0.775	5.3	0.938	Contact Map
1qvrA	3	0.6	5.1	0.938	Contact Map
2qt7A	3	0.7583	5	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.