YTOQ - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTOQ - Uncharacterized protein YtoQ

UniProt:	O34305	Sequences: MEFIVYLAGEIHSNWREEIKEKTKSLKLPITFVGPMENHDRSDNIGEEIMGVQPNAVLKDDKASDINNFRTAVLMNKADFVIALFGEKYKQWNTAMDASYAIAKGKPLIIIRPESLHHPLKELSNKANITVETVNQAIKALSYLFETE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	148 (145)
Sequences:	268 (126)
Seq/√Len:	10.4

BACSU - YTOQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_E	13_S	4.976	1.00
53_Q	62_K	3.725	0.98
23_T	32_F	3.259	0.96
116_L	119_P	3.040	0.94
4_I	33_V	2.883	0.92
78_A	81_V	2.570	0.87
36_M	41_R	2.447	0.84
44_N	59_K	2.378	0.82
18_E	135_N	2.311	0.80
61_D	65_D	2.201	0.76
29_P	145_F	2.142	0.74
13_S	119_P	2.108	0.73
47_E	63_A	2.104	0.73
21_E	24_K	1.952	0.67
124_S	130_T	1.901	0.65
72_A	76_N	1.795	0.60
69_F	144_L	1.781	0.59
2_E	31_T	1.732	0.57
59_K	63_A	1.698	0.56
56_A	59_K	1.618	0.52
45_I	63_A	1.537	0.48
102_I	123_L	1.530	0.48
110_I	141_L	1.524	0.48
117_H	132_E	1.498	0.46
74_L	144_L	1.493	0.46
35_P	78_A	1.475	0.45
45_I	101_A	1.472	0.45
135_N	142_S	1.465	0.45
66_I	140_A	1.464	0.45
114_E	132_E	1.450	0.44
45_I	66_I	1.440	0.44
22_K	135_N	1.418	0.43
29_P	80_F	1.398	0.42
20_K	32_F	1.396	0.42
35_P	81_V	1.384	0.41
87_E	119_P	1.378	0.41
18_E	134_V	1.373	0.41
50_M	66_I	1.362	0.40
80_F	87_E	1.354	0.40
3_F	80_F	1.345	0.39
101_A	108_L	1.321	0.38
111_I	131_V	1.319	0.38
73_V	107_P	1.305	0.38
49_I	101_A	1.286	0.37
113_P	116_L	1.273	0.36
80_F	141_L	1.270	0.36
22_K	138_I	1.268	0.36
26_L	142_S	1.262	0.36
27_K	56_A	1.242	0.35
94_T	99_S	1.232	0.34
81_V	101_A	1.230	0.34
71_T	74_L	1.230	0.34
47_E	130_T	1.228	0.34
52_V	135_N	1.215	0.34
72_A	81_V	1.214	0.34
36_M	76_N	1.191	0.33
47_E	116_L	1.172	0.32
83_A	101_A	1.155	0.31
30_I	138_I	1.147	0.31
65_D	88_K	1.133	0.30
3_F	145_F	1.125	0.30
4_I	106_K	1.114	0.30
45_I	107_P	1.111	0.29
3_F	144_L	1.109	0.29
72_A	99_S	1.108	0.29
14_N	141_L	1.105	0.29
77_K	107_P	1.098	0.29
20_K	138_I	1.090	0.29
71_T	144_L	1.084	0.28
63_A	130_T	1.060	0.28
129_I	140_A	1.054	0.27
19_I	73_V	1.042	0.27
19_I	105_G	1.039	0.27
14_N	18_E	1.028	0.26
65_D	125_N	1.023	0.26
30_I	114_E	1.020	0.26
33_V	74_L	1.009	0.26
48_E	140_A	1.008	0.26
31_T	104_K	1.008	0.26
5_V	18_E	1.003	0.25
36_M	58_L	1.003	0.25
37_E	111_I	0.977	0.25
99_S	130_T	0.977	0.25
84_L	126_K	0.961	0.24
21_E	25_S	0.954	0.24
13_S	36_M	0.936	0.23
119_P	134_V	0.929	0.23
21_E	52_V	0.920	0.23
20_K	37_E	0.915	0.22
101_A	130_T	0.910	0.22
5_V	30_I	0.900	0.22
117_H	139_K	0.893	0.22
49_I	81_V	0.881	0.21
13_S	38_N	0.860	0.21
38_N	41_R	0.858	0.21
28_L	89_Y	0.850	0.20
21_E	77_K	0.849	0.20
45_I	49_I	0.846	0.20
45_I	130_T	0.842	0.20
110_I	130_T	0.842	0.20
48_E	59_K	0.836	0.20
47_E	101_A	0.835	0.20
61_D	125_N	0.825	0.20
56_A	140_A	0.821	0.20
44_N	48_E	0.811	0.19
41_R	74_L	0.806	0.19
2_E	20_K	0.802	0.19
73_V	77_K	0.800	0.19
24_K	142_S	0.797	0.19
80_F	109_I	0.791	0.19
63_A	101_A	0.787	0.19
17_E	21_E	0.783	0.18
57_V	117_H	0.781	0.18
37_E	123_L	0.781	0.18
4_I	135_N	0.778	0.18
44_N	56_A	0.769	0.18
47_E	117_H	0.768	0.18
48_E	139_K	0.767	0.18
31_T	52_V	0.759	0.18
40_D	102_I	0.755	0.18
44_N	101_A	0.744	0.17
4_I	90_K	0.743	0.17
88_K	142_S	0.740	0.17
24_K	135_N	0.739	0.17
72_A	116_L	0.739	0.17
57_V	61_D	0.736	0.17
21_E	75_M	0.734	0.17
34_G	123_L	0.731	0.17
99_S	103_A	0.731	0.17
20_K	78_A	0.730	0.17
24_K	77_K	0.726	0.17
81_V	108_L	0.725	0.17
10_E	105_G	0.724	0.17
36_M	57_V	0.719	0.17
38_N	76_N	0.715	0.17
24_K	40_D	0.714	0.17
94_T	124_S	0.712	0.17
80_F	145_F	0.712	0.17
72_A	82_I	0.708	0.16
30_I	80_F	0.700	0.16
3_F	74_L	0.697	0.16
41_R	140_A	0.696	0.16
61_D	129_I	0.696	0.16
54_P	108_L	0.695	0.16
26_L	139_K	0.692	0.16
59_K	116_L	0.686	0.16
34_G	37_E	0.685	0.16
57_V	129_I	0.680	0.16
4_I	75_M	0.676	0.16
31_T	76_N	0.674	0.16
107_P	117_H	0.672	0.16
30_I	129_I	0.671	0.16
72_A	128_N	0.669	0.15
21_E	142_S	0.668	0.15
29_P	109_I	0.668	0.15
3_F	132_E	0.667	0.15
25_S	139_K	0.664	0.15
57_V	65_D	0.662	0.15
69_F	140_A	0.661	0.15
64_S	71_T	0.654	0.15
47_E	59_K	0.653	0.15
50_M	131_V	0.650	0.15
80_F	130_T	0.648	0.15
25_S	80_F	0.643	0.15
49_I	108_L	0.639	0.15
44_N	108_L	0.633	0.15
5_V	29_P	0.629	0.15
10_E	80_F	0.629	0.15
44_N	49_I	0.628	0.14
111_I	123_L	0.626	0.14
26_L	36_M	0.624	0.14
128_N	140_A	0.623	0.14
36_M	117_H	0.620	0.14
22_K	84_L	0.617	0.14
52_V	55_N	0.609	0.14
49_I	63_A	0.606	0.14
99_S	126_K	0.605	0.14
10_E	26_L	0.602	0.14
137_A	142_S	0.601	0.14
68_N	71_T	0.591	0.14
1_M	47_E	0.587	0.14
23_T	53_Q	0.584	0.13
55_N	114_E	0.583	0.13
3_F	134_V	0.578	0.13
108_L	130_T	0.578	0.13
45_I	81_V	0.577	0.13
32_F	114_E	0.570	0.13
1_M	63_A	0.558	0.13
18_E	21_E	0.557	0.13
88_K	115_S	0.557	0.13
94_T	123_L	0.547	0.13
21_E	31_T	0.545	0.13
59_K	90_K	0.544	0.13
115_S	134_V	0.542	0.13
33_V	78_A	0.539	0.13
74_L	119_P	0.537	0.12
19_I	138_I	0.536	0.12
88_K	103_A	0.535	0.12
31_T	119_P	0.531	0.12
8_A	112_R	0.519	0.12
13_S	115_S	0.518	0.12
10_E	138_I	0.517	0.12
22_K	25_S	0.516	0.12
37_E	73_V	0.514	0.12
59_K	117_H	0.508	0.12
44_N	63_A	0.508	0.12
69_F	115_S	0.507	0.12
141_L	144_L	0.504	0.12
75_M	99_S	0.504	0.12
87_E	116_L	0.503	0.12
8_A	84_L	0.502	0.12
5_V	17_E	0.501	0.12
45_I	59_K	0.501	0.12
11_I	43_D	0.500	0.12
11_I	39_H	0.500	0.12
39_H	93_N	0.500	0.12
11_I	93_N	0.500	0.12
39_H	43_D	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4jenA	2	0.7568	99.8	0.747	Contact Map
1s2dA	5	0.9527	99.7	0.766	Contact Map
4p5eA	2	0.8649	99.7	0.781	Contact Map
4jelA	2	0.8581	99.5	0.8	Contact Map
4ohrA	2	0.8581	99.5	0.803	Contact Map
1eiwA	1	0.7095	99.4	0.812	Contact Map
4jemA	2	0.8581	99.4	0.815	Contact Map
1f8yA	5	0.9122	99.4	0.819	Contact Map
3ehdA	4	0.8784	99.2	0.831	Contact Map
2f62A	2	0.8311	98.1	0.886	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.