PTXA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTXA - Putative phosphotransferase enzyme IIA component YyzE

UniProt:	O32292	Sequences: MVTPTKHAIGLRSASGVELLAHIGLDTVTFDGTPFSLKVKEGDTVKKGEVLVEFDKAFIEDIEESALHQKIFTVVS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	76 (73)
Sequences:	3117 (2338)
Seq/√Len:	273.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
38_K	53_E	2.643	1.00
38_K	50_V	2.524	1.00
34_P	58_F	2.336	1.00
40_K	43_D	2.322	1.00
36_S	53_E	2.262	1.00
6_K	37_L	2.228	1.00
23_I	52_V	2.211	1.00
58_F	62_I	2.168	1.00
29_T	64_E	2.141	1.00
14_A	44_T	2.028	1.00
33_T	62_I	1.907	1.00
46_K	49_E	1.730	1.00
9_I	52_V	1.681	1.00
56_K	66_A	1.635	1.00
23_I	54_F	1.581	1.00
56_K	60_E	1.547	1.00
66_A	69_Q	1.503	1.00
43_D	49_E	1.490	1.00
33_T	58_F	1.440	1.00
12_R	18_E	1.385	1.00
26_D	29_T	1.365	1.00
57_A	61_D	1.361	1.00
50_V	53_E	1.336	1.00
10_G	73_T	1.317	1.00
57_A	60_E	1.308	1.00
58_F	61_D	1.305	1.00
30_F	58_F	1.215	1.00
18_E	74_V	1.211	1.00
30_F	34_P	1.209	1.00
25_L	69_Q	1.200	1.00
37_L	52_V	1.148	1.00
54_F	59_I	1.119	1.00
13_S	17_V	1.107	1.00
23_I	68_H	1.099	1.00
9_I	51_L	1.068	1.00
2_V	41_E	1.064	1.00
39_V	43_D	1.050	1.00
47_K	50_V	1.045	1.00
30_F	59_I	1.045	1.00
21_A	70_K	1.031	1.00
9_I	21_A	1.026	1.00
34_P	62_I	1.025	1.00
17_V	72_F	1.025	1.00
55_D	58_F	1.010	1.00
34_P	64_E	1.001	1.00
39_V	49_E	0.996	1.00
30_F	64_E	0.987	1.00
60_E	66_A	0.981	1.00
4_P	31_D	0.955	1.00
19_L	72_F	0.936	1.00
30_F	33_T	0.899	1.00
6_K	36_S	0.894	1.00
11_L	21_A	0.828	0.99
11_L	51_L	0.811	0.99
26_D	64_E	0.808	0.99
59_I	64_E	0.807	0.99
37_L	41_E	0.806	0.99
4_P	41_E	0.800	0.99
2_V	37_L	0.778	0.99
59_I	66_A	0.750	0.99
9_I	39_V	0.744	0.99
30_F	66_A	0.737	0.99
21_A	51_L	0.731	0.99
2_V	6_K	0.716	0.99
25_L	71_I	0.715	0.98
25_L	65_S	0.697	0.98
9_I	54_F	0.679	0.98
34_P	65_S	0.665	0.98
8_A	26_D	0.663	0.98
21_A	68_H	0.658	0.97
9_I	37_L	0.657	0.97
59_I	63_E	0.654	0.97
65_S	68_H	0.649	0.97
29_T	35_F	0.647	0.97
19_L	74_V	0.630	0.97
25_L	67_L	0.629	0.97
70_K	74_V	0.626	0.97
39_V	51_L	0.624	0.96
58_F	63_E	0.612	0.96
4_P	10_G	0.598	0.96
6_K	38_K	0.598	0.96
20_L	73_T	0.596	0.95
2_V	52_V	0.588	0.95
4_P	35_F	0.580	0.95
13_S	19_L	0.575	0.94
14_A	47_K	0.565	0.94
54_F	68_H	0.557	0.94
25_L	66_A	0.553	0.93
6_K	41_E	0.552	0.93
2_V	10_G	0.544	0.93
12_R	16_G	0.542	0.93
5_T	37_L	0.542	0.93
48_G	69_Q	0.540	0.92
18_E	73_T	0.540	0.92
10_G	18_E	0.539	0.92
21_A	69_Q	0.539	0.92
3_T	37_L	0.534	0.92
38_K	52_V	0.533	0.92
30_F	55_D	0.527	0.92
2_V	39_V	0.526	0.91
14_A	46_K	0.523	0.91
3_T	6_K	0.522	0.91
26_D	67_L	0.522	0.91
40_K	60_E	0.514	0.91
59_I	62_I	0.511	0.90
10_G	20_L	0.507	0.90
10_G	60_E	0.507	0.90
19_L	45_V	0.501	0.89
2_V	9_I	0.501	0.89
30_F	62_I	0.500	0.89

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ourB	1	1	100	0.065	Contact Map
2gprA	1	1	100	0.067	Contact Map
1f3zA	2	1	100	0.07	Contact Map
1ax3A	1	1	100	0.083	Contact Map
1dczA	1	0.8026	88.7	0.845	Contact Map
4iqzA	4	0.8553	82.1	0.859	Contact Map
4tkoB	1	0.8947	79.6	0.862	Contact Map
2d5dA	1	0.7105	76.8	0.865	Contact Map
2xhaA	1	0.8026	73.7	0.869	Contact Map
1iyuA	1	0.75	70.5	0.872	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.