YWZA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YWZA - UPF0410 protein YwzA

UniProt:	O32282	Sequences: MSFLISLIVAIIIGWLGSLFVKGDMPGGIIGSMIAGLIGAWIGHGLLGTWGPHLAGFAIIPAVIGAAIVVFLVSLLTRKRG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	81 (77)
Sequences:	396 (174)
Seq/√Len:	19.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
71_F	75_L	3.437	1.00
11_I	29_I	3.203	1.00
37_L	57_F	3.103	0.99
47_L	64_I	3.046	0.99
2_S	6_S	2.496	0.97
26_P	31_G	2.495	0.97
40_A	62_A	2.324	0.96
52_P	59_I	2.008	0.91
42_I	69_V	2.002	0.91
6_S	37_L	1.823	0.86
27_G	31_G	1.807	0.86
5_I	57_F	1.715	0.82
16_L	19_L	1.698	0.82
53_H	58_A	1.696	0.82
11_I	33_M	1.690	0.81
72_L	76_L	1.540	0.75
52_P	60_I	1.518	0.74
46_L	68_I	1.462	0.71
24_D	31_G	1.435	0.69
71_F	76_L	1.414	0.68
24_D	27_G	1.347	0.64
3_F	6_S	1.334	0.63
15_W	19_L	1.298	0.61
16_L	24_D	1.240	0.58
40_A	70_V	1.215	0.56
44_H	47_L	1.198	0.55
3_F	64_I	1.195	0.55
69_V	73_V	1.184	0.54
55_A	58_A	1.175	0.54
7_L	32_S	1.155	0.52
67_A	71_F	1.142	0.51
56_G	60_I	1.140	0.51
13_I	70_V	1.133	0.51
13_I	62_A	1.123	0.50
3_F	41_W	1.099	0.49
11_I	32_S	1.049	0.45
43_G	48_G	1.000	0.42
11_I	15_W	0.996	0.42
10_A	32_S	0.992	0.42
23_G	26_P	0.991	0.42
2_S	44_H	0.990	0.42
6_S	55_A	0.961	0.40
6_S	57_F	0.955	0.39
18_S	21_V	0.953	0.39
58_A	61_P	0.907	0.37
64_I	70_V	0.905	0.36
35_A	73_V	0.883	0.35
57_F	62_A	0.881	0.35
5_I	23_G	0.873	0.35
31_G	41_W	0.867	0.34
25_M	31_G	0.866	0.34
37_L	63_V	0.860	0.34
50_W	60_I	0.831	0.32
41_W	45_G	0.796	0.30
17_G	74_S	0.790	0.30
37_L	44_H	0.789	0.30
7_L	33_M	0.773	0.29
49_T	66_A	0.769	0.29
12_I	15_W	0.765	0.29
7_L	74_S	0.755	0.28
15_W	77_T	0.753	0.28
17_G	20_F	0.749	0.28
3_F	62_A	0.738	0.27
17_G	22_K	0.717	0.26
46_L	58_A	0.716	0.26
63_V	67_A	0.706	0.26
26_P	41_W	0.703	0.25
19_L	29_I	0.702	0.25
43_G	61_P	0.701	0.25
12_I	77_T	0.690	0.25
47_L	50_W	0.684	0.24
68_I	74_S	0.672	0.24
13_I	55_A	0.670	0.24
58_A	68_I	0.661	0.23
22_K	25_M	0.659	0.23
73_V	77_T	0.658	0.23
29_I	33_M	0.653	0.23
75_L	78_R	0.649	0.23
5_I	9_V	0.644	0.23
5_I	54_L	0.638	0.22
42_I	45_G	0.638	0.22
47_L	53_H	0.620	0.22
12_I	69_V	0.614	0.21
38_I	47_L	0.607	0.21
48_G	61_P	0.601	0.21
20_F	67_A	0.596	0.21
37_L	54_L	0.596	0.21
21_V	27_G	0.594	0.20
15_W	29_I	0.592	0.20
5_I	10_A	0.589	0.20
19_L	24_D	0.589	0.20
45_G	76_L	0.588	0.20
34_I	38_I	0.586	0.20
33_M	76_L	0.585	0.20
6_S	66_A	0.583	0.20
34_I	63_V	0.576	0.20
30_I	49_T	0.573	0.20
27_G	34_I	0.571	0.19
3_F	42_I	0.571	0.19
20_F	68_I	0.565	0.19
12_I	45_G	0.557	0.19
9_V	59_I	0.554	0.19
15_W	26_P	0.543	0.18
20_F	74_S	0.536	0.18
22_K	67_A	0.522	0.18
30_I	77_T	0.522	0.18
55_A	63_V	0.515	0.17
12_I	16_L	0.515	0.17
9_V	13_I	0.514	0.17
54_L	60_I	0.513	0.17
22_K	27_G	0.513	0.17
49_T	53_H	0.507	0.17
19_L	30_I	0.501	0.17
12_I	53_H	0.501	0.17
8_I	33_M	0.501	0.17
23_G	42_I	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4z7fA	2	0.9877	27.7	0.904	Contact Map
4wgvA	2	0.8642	25.6	0.905	Contact Map
3dh4A	3	0.9506	10.5	0.92	Contact Map
2xq2A	2	0.9506	8	0.924	Contact Map
3rlbA	1	0.9259	7.2	0.926	Contact Map
4rfsS	1	0.9259	7.1	0.926	Contact Map
2b2hA	3	0.9136	5.8	0.929	Contact Map
4hzuS	1	0.7531	5.8	0.93	Contact Map
4pd6A	3	0.2593	5.7	0.93	Contact Map
2kluA	1	0.3827	5.4	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.