TUAA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TUAA - Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase

UniProt:	O32274	Sequences: MSAEKSMNVSREFSVQQIHSFTLSEKTARYLAIKRVMDIWFALIGLAIALPMIAVFSILICLETPGPAIYTQERVGKGGKPFKLYKLRSMKIDAEKSGAVWAQKQDPRVTRIGAFIRRTRIDELPQLFNVLKGDMSMIGPRPERPVFTEKFQNEIPGFTQRLGSGERRLRYDAEGKADI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	179 (152)
Sequences:	8373 (5797)
Seq/√Len:	470.2

ECOLI - WCAJ
BACSU - TUAA EPSL
HALSA - Q9HSZ7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_R	39_I	4.098	1.00
73_E	81_P	3.319	1.00
71_T	83_K	3.265	1.00
73_E	83_K	3.140	1.00
56_F	121_I	2.843	1.00
59_L	112_I	2.821	1.00
63_E	111_R	2.494	1.00
115_F	119_T	2.477	1.00
173_A	176_K	2.467	1.00
161_R	164_S	2.287	1.00
76_G	156_P	2.259	1.00
130_V	158_F	2.149	1.00
120_R	166_E	1.984	1.00
61_C	66_G	1.946	1.00
67_P	92_I	1.862	1.00
85_Y	129_N	1.816	1.00
37_M	41_F	1.809	1.00
89_S	116_I	1.776	1.00
143_E	147_F	1.771	1.00
56_F	87_L	1.765	1.00
43_L	131_L	1.764	1.00
46_L	128_F	1.761	1.00
81_P	145_P	1.746	1.00
61_C	68_A	1.740	1.00
42_A	46_L	1.736	1.00
138_I	159_T	1.695	1.00
57_S	68_A	1.685	1.00
165_G	169_L	1.670	1.00
71_T	85_Y	1.664	1.00
53_I	87_L	1.610	1.00
38_D	136_S	1.593	1.00
56_F	116_I	1.571	1.00
69_I	85_Y	1.504	1.00
75_V	81_P	1.459	1.00
41_F	137_M	1.457	1.00
55_V	59_L	1.440	1.00
45_G	49_A	1.419	1.00
170_R	173_A	1.415	1.00
128_F	132_K	1.402	1.00
152_Q	155_I	1.386	1.00
60_I	64_T	1.380	1.00
160_Q	174_E	1.363	1.00
39_I	43_L	1.355	1.00
75_V	148_T	1.317	1.00
51_P	54_A	1.317	1.00
171_Y	174_E	1.303	1.00
67_P	88_R	1.278	1.00
42_A	131_L	1.274	1.00
45_G	127_L	1.238	1.00
45_G	137_M	1.221	1.00
47_A	50_L	1.215	1.00
60_I	63_E	1.201	1.00
144_R	147_F	1.196	1.00
41_F	45_G	1.185	1.00
147_F	151_F	1.173	1.00
143_E	148_T	1.167	1.00
58_I	62_L	1.153	1.00
129_N	134_D	1.147	1.00
145_P	149_E	1.145	1.00
91_K	94_A	1.145	1.00
39_I	42_A	1.143	1.00
42_A	47_A	1.114	1.00
127_L	137_M	1.102	1.00
143_E	151_F	1.100	1.00
112_I	116_I	1.098	1.00
34_K	38_D	1.098	1.00
116_I	119_T	1.088	1.00
161_R	177_A	1.084	1.00
49_A	53_I	1.083	1.00
120_R	167_R	1.053	1.00
46_L	50_L	1.049	1.00
162_L	174_E	1.034	1.00
93_D	96_K	1.033	1.00
61_C	64_T	1.030	1.00
56_F	59_L	0.987	1.00
97_S	100_V	0.984	1.00
143_E	171_Y	0.981	1.00
102_A	162_L	0.978	1.00
34_K	136_S	0.974	1.00
66_G	92_I	0.973	1.00
63_E	112_I	0.971	1.00
49_A	52_M	0.960	1.00
43_L	47_A	0.958	1.00
151_F	171_Y	0.951	1.00
91_K	107_P	0.948	1.00
85_Y	132_K	0.945	1.00
59_L	63_E	0.942	1.00
70_Y	95_E	0.942	1.00
54_A	58_I	0.938	1.00
29_R	32_A	0.927	1.00
57_S	60_I	0.908	1.00
82_F	135_M	0.906	1.00
72_Q	84_L	0.905	1.00
68_A	87_L	0.904	1.00
39_I	131_L	0.898	1.00
105_Q	114_A	0.898	1.00
130_V	137_M	0.889	1.00
53_I	124_L	0.887	1.00
85_Y	128_F	0.884	1.00
50_L	53_I	0.881	1.00
143_E	174_E	0.862	1.00
53_I	69_I	0.859	1.00
170_R	174_E	0.855	1.00
148_T	151_F	0.854	1.00
124_L	127_L	0.853	1.00
140_P	156_P	0.852	1.00
100_V	174_E	0.849	1.00
109_V	114_A	0.846	1.00
75_V	145_P	0.846	1.00
146_V	151_F	0.834	1.00
51_P	55_V	0.830	1.00
101_W	151_F	0.815	1.00
52_M	56_F	0.812	1.00
128_F	134_D	0.810	1.00
172_D	176_K	0.810	1.00
50_L	54_A	0.806	1.00
63_E	110_T	0.800	1.00
144_R	151_F	0.785	1.00
60_I	68_A	0.778	1.00
101_W	147_F	0.774	1.00
59_L	62_L	0.771	1.00
120_R	165_G	0.764	1.00
171_Y	175_G	0.764	1.00
162_L	165_G	0.758	1.00
40_W	44_I	0.755	1.00
60_I	88_R	0.755	1.00
165_G	168_R	0.753	1.00
64_T	112_I	0.752	1.00
144_R	171_Y	0.751	1.00
46_L	131_L	0.746	1.00
61_C	67_P	0.745	1.00
154_E	176_K	0.742	1.00
64_T	88_R	0.731	1.00
75_V	144_R	0.730	1.00
84_L	126_Q	0.728	1.00
48_I	51_P	0.724	1.00
147_F	162_L	0.724	1.00
111_R	114_A	0.714	1.00
28_A	31_L	0.713	1.00
167_R	174_E	0.712	1.00
169_L	174_E	0.712	1.00
143_E	162_L	0.707	1.00
112_I	115_F	0.697	1.00
151_F	155_I	0.697	1.00
100_V	103_Q	0.690	1.00
29_R	33_I	0.687	1.00
57_S	61_C	0.686	1.00
53_I	56_F	0.685	1.00
101_W	143_E	0.684	1.00
33_I	36_V	0.684	1.00
49_A	56_F	0.684	1.00
70_Y	144_R	0.681	1.00
49_A	127_L	0.674	1.00
169_L	177_A	0.673	1.00
111_R	115_F	0.668	1.00
164_S	177_A	0.667	1.00
118_R	126_Q	0.665	1.00
41_F	44_I	0.664	1.00
49_A	87_L	0.660	1.00
143_E	175_G	0.659	1.00
102_A	147_F	0.654	1.00
155_I	175_G	0.651	1.00
31_L	77_K	0.650	1.00
35_R	38_D	0.649	1.00
36_V	39_I	0.643	1.00
140_P	174_E	0.641	1.00
42_A	49_A	0.638	1.00
147_F	171_Y	0.626	0.99
32_A	36_V	0.622	0.99
53_I	128_F	0.621	0.99
30_Y	33_I	0.618	0.99
60_I	87_L	0.617	0.99
147_F	150_K	0.614	0.99
73_E	145_P	0.609	0.99
101_W	168_R	0.605	0.99
98_G	101_W	0.603	0.99
173_A	177_A	0.602	0.99
102_A	167_R	0.601	0.99
116_I	121_I	0.599	0.99
65_P	88_R	0.591	0.99
54_A	57_S	0.589	0.99
101_W	144_R	0.589	0.99
140_P	144_R	0.585	0.99
39_I	136_S	0.582	0.99
33_I	37_M	0.579	0.99
99_A	174_E	0.578	0.99
46_L	53_I	0.578	0.99
90_M	108_R	0.575	0.99
143_E	155_I	0.575	0.99
95_E	108_R	0.568	0.99
116_I	126_Q	0.567	0.99
127_L	158_F	0.566	0.99
155_I	171_Y	0.565	0.99
61_C	65_P	0.565	0.99
143_E	167_R	0.563	0.99
115_F	121_I	0.563	0.99
60_I	112_I	0.560	0.99
64_T	126_Q	0.554	0.99
104_K	168_R	0.553	0.99
95_E	98_G	0.552	0.99
167_R	171_Y	0.552	0.99
36_V	40_W	0.550	0.99
39_I	46_L	0.550	0.99
41_F	127_L	0.549	0.99
37_M	137_M	0.548	0.99
55_V	58_I	0.547	0.99
102_A	106_D	0.546	0.99
99_A	160_Q	0.544	0.99
146_V	150_K	0.544	0.99
42_A	137_M	0.543	0.99
95_E	102_A	0.541	0.98
71_T	84_L	0.541	0.98
88_R	116_I	0.540	0.98
102_A	107_P	0.538	0.98
37_M	40_W	0.536	0.98
35_R	42_A	0.531	0.98
28_A	32_A	0.530	0.98
97_S	103_Q	0.530	0.98
168_R	171_Y	0.525	0.98
172_D	175_G	0.523	0.98
57_S	87_L	0.518	0.98
44_I	47_A	0.516	0.98
47_A	51_P	0.516	0.98
165_G	177_A	0.514	0.98
128_F	131_L	0.511	0.98
62_L	65_P	0.511	0.98
85_Y	134_D	0.502	0.98
90_M	109_V	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3floA	3	0.4581	9.4	0.959	Contact Map
1jb0F	1	0.5419	6.5	0.962	Contact Map
4hi1A	3	0.2793	6.3	0.962	Contact Map
4kt0F	1	0.5251	6.1	0.962	Contact Map
2m8rA	1	0.3296	4.7	0.964	Contact Map
2bjdA	1	0.2737	3.9	0.966	Contact Map
4guaA	3	0.324	3.5	0.966	Contact Map
4w8pB	1	0.1173	3.1	0.967	Contact Map
2kogA	1	0.3073	3.1	0.967	Contact Map
3fymA	1	0.0838	2.9	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.