YVBK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVBK - Uncharacterized N-acetyltransferase YvbK

UniProt:	O32248	Sequences: MNMQKLRIELGEETNDELYDLLLLADPSKDIVDEYLERGECYTAWAGDELAGVYVLLKTRPQTVEIVNIAVKESLQKKGFGKQLVLDAIEKAKKLGADTIEIGTGNSSIHQLSLYQKCGFRIQAIDHDFFLRHYDEDIFENGIQCRDMVRLYLDL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	155 (146)
Sequences:	772 (655)
Seq/√Len:	54.2

BACSU - YVBK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_G	71_V	3.451	1.00
89_I	153_L	3.303	1.00
103_G	148_M	3.176	1.00
139_F	144_Q	3.169	1.00
128_D	132_R	2.701	1.00
89_I	100_I	2.528	1.00
42_Y	91_K	2.452	1.00
64_V	97_A	2.293	1.00
44_A	80_F	2.261	1.00
66_I	102_I	2.219	1.00
129_F	148_M	2.183	1.00
122_I	125_I	2.169	1.00
102_I	114_L	2.147	1.00
24_L	76_Q	2.145	1.00
9_E	45_W	2.074	1.00
29_K	33_D	2.052	1.00
121_R	147_D	2.048	1.00
10_L	40_E	2.030	1.00
112_L	151_L	1.944	1.00
116_Q	122_I	1.915	1.00
45_W	50_L	1.891	0.99
105_G	145_C	1.839	0.99
107_S	145_C	1.804	0.99
106_N	145_C	1.760	0.99
58_K	97_A	1.740	0.99
54_Y	66_I	1.718	0.99
43_T	50_L	1.688	0.99
39_G	55_V	1.676	0.99
85_V	118_C	1.633	0.98
75_L	78_K	1.598	0.98
54_Y	88_A	1.562	0.98
24_L	70_A	1.555	0.98
126_D	132_R	1.520	0.98
19_Y	29_K	1.517	0.98
122_I	149_V	1.503	0.97
62_Q	98_D	1.500	0.97
54_Y	87_D	1.439	0.97
103_G	129_F	1.432	0.96
44_A	52_G	1.432	0.96
17_E	36_L	1.390	0.96
123_Q	152_Y	1.362	0.95
131_L	146_R	1.361	0.95
64_V	100_I	1.360	0.95
110_H	113_S	1.359	0.95
99_T	152_Y	1.351	0.95
128_D	146_R	1.343	0.95
56_L	92_A	1.340	0.95
52_G	84_L	1.323	0.94
69_I	114_L	1.321	0.94
82_K	118_C	1.318	0.94
67_V	129_F	1.315	0.94
131_L	144_Q	1.303	0.94
71_V	80_F	1.273	0.93
46_A	78_K	1.247	0.93
82_K	117_K	1.235	0.92
87_D	91_K	1.220	0.92
108_S	111_Q	1.216	0.92
138_I	141_N	1.165	0.90
59_T	63_T	1.153	0.89
31_I	34_E	1.148	0.89
77_K	117_K	1.146	0.89
101_E	150_R	1.145	0.89
40_E	95_L	1.137	0.89
14_T	17_E	1.127	0.88
56_L	88_A	1.122	0.88
52_G	81_G	1.119	0.88
82_K	110_H	1.118	0.88
126_D	148_M	1.084	0.86
9_E	15_N	1.077	0.86
126_D	150_R	1.070	0.85
38_R	60_R	1.068	0.85
25_A	102_I	1.064	0.85
19_Y	33_D	1.041	0.84
51_A	80_F	1.012	0.82
38_R	59_T	1.005	0.81
107_S	149_V	1.003	0.81
38_R	57_L	1.000	0.81
22_L	26_D	0.991	0.81
46_A	51_A	0.989	0.80
89_I	120_F	0.986	0.80
106_N	143_I	0.982	0.80
16_D	33_D	0.982	0.80
108_S	145_C	0.973	0.79
69_I	85_V	0.940	0.77
107_S	110_H	0.934	0.76
112_L	116_Q	0.929	0.76
116_Q	121_R	0.915	0.75
85_V	149_V	0.910	0.75
91_K	94_K	0.892	0.73
71_V	81_G	0.888	0.73
124_A	150_R	0.887	0.73
106_N	116_Q	0.876	0.72
103_G	126_D	0.871	0.71
42_Y	87_D	0.867	0.71
113_S	141_N	0.867	0.71
8_I	84_L	0.864	0.71
44_A	51_A	0.862	0.71
66_I	114_L	0.859	0.70
35_Y	104_T	0.854	0.70
36_L	55_V	0.845	0.69
16_D	49_E	0.838	0.68
38_R	118_C	0.835	0.68
82_K	86_L	0.828	0.67
30_D	135_D	0.823	0.67
106_N	112_L	0.812	0.66
8_I	87_D	0.801	0.65
123_Q	127_H	0.787	0.63
137_D	144_Q	0.781	0.63
20_D	24_L	0.771	0.62
65_E	104_T	0.767	0.61
66_I	85_V	0.766	0.61
39_G	57_L	0.756	0.60
107_S	113_S	0.752	0.60
15_N	18_L	0.750	0.60
53_V	146_R	0.750	0.60
107_S	140_E	0.744	0.59
108_S	140_E	0.743	0.59
115_Y	120_F	0.715	0.56
45_W	49_E	0.715	0.56
106_N	122_I	0.712	0.56
113_S	143_I	0.700	0.54
110_H	141_N	0.698	0.54
104_T	115_Y	0.695	0.54
121_R	146_R	0.692	0.54
38_R	67_V	0.683	0.53
47_G	139_F	0.681	0.52
73_E	76_Q	0.681	0.52
26_D	35_Y	0.679	0.52
122_I	145_C	0.678	0.52
56_L	64_V	0.675	0.52
41_C	55_V	0.664	0.51
91_K	95_L	0.663	0.51
85_V	154_D	0.661	0.50
145_C	149_V	0.658	0.50
35_Y	68_N	0.657	0.50
31_I	129_F	0.656	0.50
111_Q	145_C	0.651	0.49
12_E	17_E	0.649	0.49
60_R	63_T	0.647	0.49
55_V	103_G	0.645	0.49
86_L	94_K	0.644	0.49
87_D	95_L	0.642	0.48
16_D	37_E	0.641	0.48
69_I	81_G	0.641	0.48
51_A	154_D	0.638	0.48
45_W	72_K	0.633	0.47
45_W	48_D	0.630	0.47
68_N	130_F	0.627	0.47
57_L	67_V	0.626	0.47
76_Q	151_L	0.626	0.47
58_K	153_L	0.621	0.46
57_L	63_T	0.619	0.46
130_F	134_Y	0.618	0.46
105_G	111_Q	0.617	0.46
12_E	74_S	0.613	0.45
82_K	113_S	0.611	0.45
103_G	150_R	0.611	0.45
11_G	43_T	0.610	0.45
104_T	130_F	0.605	0.44
101_E	148_M	0.600	0.44
104_T	108_S	0.599	0.44
144_Q	153_L	0.597	0.44
16_D	20_D	0.596	0.43
49_E	72_K	0.595	0.43
127_H	152_Y	0.595	0.43
86_L	95_L	0.594	0.43
113_S	116_Q	0.589	0.43
41_C	53_V	0.587	0.42
38_R	61_P	0.585	0.42
67_V	123_Q	0.580	0.42
31_I	39_G	0.580	0.42
64_V	92_A	0.578	0.42
27_P	136_E	0.577	0.41
59_T	62_Q	0.576	0.41
81_G	115_Y	0.576	0.41
22_L	68_N	0.575	0.41
67_V	150_R	0.572	0.41
85_V	102_I	0.571	0.41
21_L	84_L	0.568	0.41
70_A	115_Y	0.566	0.40
106_N	149_V	0.563	0.40
30_D	37_E	0.559	0.40
85_V	151_L	0.557	0.39
99_T	154_D	0.555	0.39
131_L	135_D	0.552	0.39
62_Q	83_Q	0.552	0.39
66_I	100_I	0.545	0.38
39_G	67_V	0.544	0.38
60_R	67_V	0.543	0.38
51_A	75_L	0.541	0.38
105_G	130_F	0.538	0.37
147_D	150_R	0.536	0.37
60_R	135_D	0.533	0.37
122_I	151_L	0.533	0.37
121_R	125_I	0.531	0.37
63_T	101_E	0.530	0.37
46_A	49_E	0.530	0.37
40_E	100_I	0.529	0.37
79_G	82_K	0.527	0.36
23_L	26_D	0.523	0.36
77_K	118_C	0.523	0.36
28_S	31_I	0.522	0.36
65_E	103_G	0.521	0.36
48_D	137_D	0.520	0.36
48_D	95_L	0.519	0.36
93_K	98_D	0.519	0.36
69_I	100_I	0.516	0.35
116_Q	125_I	0.515	0.35
111_Q	138_I	0.515	0.35
108_S	141_N	0.511	0.35
13_E	47_G	0.508	0.35
83_Q	98_D	0.507	0.34
11_G	18_L	0.506	0.34
24_L	73_E	0.505	0.34
35_Y	134_Y	0.505	0.34
46_A	75_L	0.504	0.34
30_D	74_S	0.502	0.34
116_Q	143_I	0.500	0.34
27_P	145_C	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y9kA	1	0.9742	99.9	0.44	Contact Map
1yvkA	3	0.9742	99.9	0.466	Contact Map
2oh1A	1	0.871	99.8	0.583	Contact Map
2r7hA	2	0.8968	99.8	0.587	Contact Map
1n71A	4	0.8903	99.8	0.589	Contact Map
3pp9A	2	0.9484	99.8	0.591	Contact Map
3lodA	1	0.8645	99.8	0.591	Contact Map
1gheA	1	0.9161	99.8	0.592	Contact Map
2fiaA	1	0.8968	99.8	0.593	Contact Map
4kvxA	1	0.8839	99.7	0.596	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.