SSRP - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SSRP - SsrA-binding protein

UniProt:	O32230	Sequences: MPKGSGKVLSQNKKANHDYFIEETYETGIVLQGTEIKSIRAGRVNLKDSFAKIERGEVFLHNMHVSPYEQGNRYNHDPLRTRKLLMHRKEINKLIGLTKEKGYSLVPLKLYLKNGFAKVLLGLGKGKKNYDKREDLKRKDAKREIERAFRDSQKGF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	156 (146)
Sequences:	3057 (1602)
Seq/√Len:	132.6

ECOLI - SSRP
BACSU - SSRP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_L	63_M	2.562	1.00
49_S	63_M	2.503	1.00
24_T	120_L	2.383	1.00
138_R	142_K	2.310	1.00
142_K	146_E	2.264	1.00
22_E	103_Y	2.232	1.00
44_V	110_L	2.183	1.00
21_I	108_L	2.161	1.00
57_E	83_K	2.155	1.00
58_V	86_M	2.129	1.00
109_K	120_L	2.128	1.00
134_E	138_R	2.107	1.00
21_I	124_G	1.967	1.00
21_I	122_G	1.951	1.00
30_V	83_K	1.893	1.00
88_R	92_N	1.826	1.00
61_H	81_T	1.825	1.00
36_I	117_A	1.811	1.00
52_K	61_H	1.783	1.00
60_L	119_V	1.772	1.00
51_A	58_V	1.742	1.00
141_A	145_I	1.733	1.00
22_E	125_K	1.693	1.00
53_I	58_V	1.686	1.00
51_A	121_L	1.677	1.00
16_N	24_T	1.648	1.00
39_I	44_V	1.632	1.00
34_T	76_H	1.621	1.00
14_K	18_D	1.619	1.00
9_L	112_L	1.592	1.00
136_L	139_K	1.584	1.00
58_V	91_I	1.569	1.00
34_T	71_G	1.534	1.00
95_I	99_K	1.528	1.00
26_E	111_Y	1.521	1.00
53_I	91_I	1.487	1.00
54_E	81_T	1.472	1.00
11_Q	16_N	1.469	1.00
36_I	112_L	1.469	1.00
136_L	140_D	1.464	1.00
25_Y	94_L	1.464	1.00
127_K	135_D	1.455	1.00
64_H	79_L	1.419	1.00
27_T	86_M	1.376	1.00
20_F	125_K	1.372	1.00
11_Q	109_K	1.367	1.00
34_T	75_N	1.346	1.00
145_I	148_A	1.344	1.00
29_I	119_V	1.335	1.00
105_L	121_L	1.293	1.00
141_A	148_A	1.286	1.00
103_Y	125_K	1.285	1.00
46_L	63_M	1.281	1.00
92_N	96_G	1.279	1.00
9_L	117_A	1.269	1.00
140_D	144_E	1.257	1.00
51_A	105_L	1.245	1.00
137_K	141_A	1.232	1.00
86_M	91_I	1.222	1.00
87_H	116_F	1.220	1.00
97_L	100_E	1.217	1.00
135_D	138_R	1.211	1.00
110_L	119_V	1.202	0.99
25_Y	86_M	1.197	0.99
97_L	123_L	1.181	0.99
6_G	109_K	1.164	0.99
71_G	75_N	1.128	0.99
39_I	65_V	1.123	0.99
36_I	39_I	1.121	0.99
41_A	69_E	1.108	0.99
134_E	137_K	1.096	0.99
144_E	147_R	1.089	0.99
50_F	61_H	1.079	0.99
26_E	87_H	1.075	0.99
45_N	48_D	1.069	0.99
142_K	145_I	1.058	0.99
53_I	105_L	1.053	0.99
140_D	143_R	1.038	0.99
21_I	24_T	1.020	0.98
108_L	122_G	1.013	0.98
16_N	21_I	1.004	0.98
59_F	81_T	1.003	0.98
8_V	11_Q	0.992	0.98
98_T	105_L	0.976	0.98
143_R	146_E	0.973	0.98
39_I	112_L	0.966	0.98
63_M	110_L	0.961	0.98
54_E	61_H	0.958	0.97
40_R	112_L	0.955	0.97
92_N	95_I	0.940	0.97
39_I	117_A	0.937	0.97
20_F	135_D	0.934	0.97
90_E	93_K	0.932	0.97
94_L	105_L	0.919	0.97
9_L	40_R	0.918	0.97
67_P	77_D	0.915	0.97
64_H	78_P	0.912	0.97
56_G	95_I	0.906	0.96
111_Y	120_L	0.903	0.96
86_M	123_L	0.894	0.96
14_K	47_K	0.888	0.96
139_K	142_K	0.875	0.96
41_A	70_Q	0.866	0.95
58_V	105_L	0.862	0.95
24_T	109_K	0.858	0.95
72_N	75_N	0.858	0.95
52_K	81_T	0.854	0.95
6_G	113_K	0.844	0.95
110_L	117_A	0.839	0.95
29_I	117_A	0.835	0.94
9_L	110_L	0.834	0.94
68_Y	71_G	0.833	0.94
146_E	150_R	0.824	0.94
29_I	84_L	0.824	0.94
135_D	139_K	0.822	0.94
8_V	109_K	0.811	0.94
25_Y	123_L	0.809	0.94
44_V	63_M	0.804	0.93
10_S	44_V	0.799	0.93
27_T	119_V	0.797	0.93
20_F	127_K	0.796	0.93
59_F	83_K	0.786	0.93
95_I	98_T	0.781	0.92
101_K	125_K	0.781	0.92
32_Q	76_H	0.775	0.92
145_I	149_F	0.770	0.92
96_G	100_E	0.768	0.92
26_E	113_K	0.762	0.91
49_S	107_P	0.745	0.90
18_D	129_N	0.745	0.90
43_R	66_S	0.739	0.90
25_Y	90_E	0.736	0.90
89_K	92_N	0.729	0.89
50_F	62_N	0.727	0.89
112_L	116_F	0.720	0.89
104_S	124_G	0.710	0.88
107_P	119_V	0.709	0.88
94_L	98_T	0.699	0.87
112_L	117_A	0.695	0.87
15_A	108_L	0.688	0.87
106_V	124_G	0.686	0.86
60_L	82_R	0.685	0.86
14_K	17_H	0.683	0.86
96_G	99_K	0.679	0.86
113_K	116_F	0.676	0.86
29_I	110_L	0.674	0.85
79_L	82_R	0.674	0.85
67_P	78_P	0.670	0.85
89_K	97_L	0.664	0.85
100_E	103_Y	0.664	0.85
18_D	47_K	0.664	0.85
97_L	101_K	0.662	0.84
97_L	103_Y	0.658	0.84
47_K	79_L	0.658	0.84
34_T	73_R	0.656	0.84
16_N	108_L	0.652	0.83
104_S	126_G	0.650	0.83
30_V	116_F	0.647	0.83
45_N	64_H	0.645	0.83
24_T	122_G	0.642	0.83
94_L	123_L	0.633	0.82
67_P	76_H	0.632	0.82
34_T	74_Y	0.619	0.80
38_S	66_S	0.616	0.80
53_I	95_I	0.615	0.80
56_G	88_R	0.611	0.79
15_A	106_V	0.611	0.79
87_H	90_E	0.610	0.79
17_H	20_F	0.606	0.79
10_S	49_S	0.606	0.79
34_T	72_N	0.605	0.79
146_E	149_F	0.604	0.79
10_S	26_E	0.604	0.79
96_G	123_L	0.600	0.78
138_R	141_A	0.597	0.78
112_L	115_G	0.594	0.77
27_T	105_L	0.594	0.77
58_V	87_H	0.590	0.77
23_E	93_K	0.590	0.77
38_S	68_Y	0.588	0.77
16_N	139_K	0.579	0.76
32_Q	80_R	0.576	0.75
9_L	39_I	0.576	0.75
56_G	96_G	0.574	0.75
46_L	145_I	0.567	0.74
45_N	66_S	0.565	0.74
39_I	66_S	0.562	0.73
48_D	63_M	0.559	0.73
143_R	147_R	0.557	0.73
13_K	17_H	0.550	0.72
17_H	135_D	0.549	0.72
26_E	120_L	0.545	0.71
15_A	124_G	0.543	0.71
25_Y	93_K	0.542	0.71
62_N	79_L	0.541	0.71
140_D	147_R	0.540	0.71
47_K	66_S	0.536	0.70
37_K	90_E	0.535	0.70
9_L	44_V	0.533	0.70
32_Q	72_N	0.533	0.70
32_Q	82_R	0.531	0.69
17_H	132_K	0.530	0.69
20_F	124_G	0.528	0.69
144_E	148_A	0.524	0.68
17_H	127_K	0.522	0.68
46_L	66_S	0.518	0.67
20_F	103_Y	0.518	0.67
103_Y	128_K	0.514	0.67
9_L	13_K	0.513	0.67
38_S	67_P	0.510	0.66
83_K	91_I	0.510	0.66
16_N	135_D	0.509	0.66
39_I	110_L	0.508	0.66
18_D	50_F	0.506	0.66
7_K	42_G	0.506	0.66
22_E	97_L	0.506	0.66
108_L	124_G	0.503	0.65
17_H	136_L	0.500	0.65
34_T	112_L	0.500	0.65

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1p6vA	1	0.7949	100	0.053	Contact Map
1j1hA	1	0.7821	100	0.065	Contact Map
1wjxA	1	0.7115	100	0.197	Contact Map
4q28A	1	0.3462	7.7	0.961	Contact Map
1pmhX	1	0.4103	5.1	0.964	Contact Map
4cycA	1	0.3269	4.7	0.964	Contact Map
4pasA	1	0.2244	3	0.968	Contact Map
1t6aA	1	0.4359	2.5	0.969	Contact Map
3wx4A	2	0.2051	2.3	0.97	Contact Map
1ri9A	1	0.3333	2.2	0.97	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.