CSOR - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CSOR - Copper-sensing transcriptional repressor CsoR

UniProt:	O32222	Sequences: MEKHNEHKTLNHKSSKEKDQITNRLKRIEGQVRGIQNMVENDRYCVDILVQISAVQAAMKNVALHLLEDHAHHCVADAIKSGDGEQAISELLDVFKKFTKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	101 (88)
Sequences:	1875 (1054)
Seq/√Len:	112.3

ECOLI - RCNR FRMR
BACSU - CSOR

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_E	33_R	4.229	1.00
26_K	36_Q	3.404	1.00
35_I	55_V	3.135	1.00
19_D	23_N	2.981	1.00
37_N	41_N	2.872	1.00
32_V	55_V	2.309	1.00
56_Q	60_K	1.994	1.00
25_L	32_V	1.912	1.00
29_E	32_V	1.742	1.00
18_K	42_D	1.731	1.00
89_S	93_D	1.721	1.00
28_I	62_V	1.665	1.00
20_Q	23_N	1.652	1.00
17_E	20_Q	1.619	1.00
23_N	27_R	1.617	1.00
28_I	32_V	1.565	1.00
21_I	39_V	1.557	1.00
44_Y	47_D	1.426	1.00
46_V	90_E	1.399	1.00
52_I	59_M	1.392	1.00
76_A	85_E	1.389	1.00
22_T	36_Q	1.383	1.00
52_I	63_A	1.344	1.00
25_L	39_V	1.331	1.00
27_R	58_A	1.296	0.99
44_Y	90_E	1.277	0.99
44_Y	70_H	1.273	0.99
23_N	26_K	1.268	0.99
22_T	40_E	1.234	0.99
76_A	80_K	1.221	0.99
68_E	72_H	1.191	0.99
24_R	58_A	1.157	0.99
85_E	89_S	1.153	0.99
15_S	42_D	1.143	0.99
77_D	81_S	1.099	0.98
57_A	61_N	1.062	0.98
29_E	36_Q	1.045	0.98
28_I	55_V	1.042	0.97
64_L	99_T	1.036	0.97
43_R	48_I	1.017	0.97
54_A	61_N	1.012	0.97
76_A	79_I	1.002	0.97
64_L	96_K	1.001	0.97
68_E	89_S	0.999	0.97
46_V	50_V	0.999	0.97
67_L	95_F	0.998	0.97
60_K	100_K	0.984	0.96
61_N	65_H	0.981	0.96
71_A	75_V	0.957	0.96
21_I	65_H	0.956	0.96
91_L	95_F	0.954	0.96
27_R	31_Q	0.951	0.96
52_I	62_V	0.931	0.95
68_E	96_K	0.930	0.95
68_E	92_L	0.922	0.95
63_A	98_F	0.921	0.95
79_I	82_G	0.920	0.95
49_L	63_A	0.906	0.94
79_I	88_I	0.893	0.94
65_H	68_E	0.881	0.94
33_R	59_M	0.873	0.93
44_Y	75_V	0.870	0.93
20_Q	65_H	0.867	0.93
57_A	60_K	0.859	0.93
78_A	87_A	0.857	0.93
92_L	96_K	0.857	0.93
78_A	83_D	0.854	0.92
16_K	20_Q	0.848	0.92
72_H	85_E	0.820	0.91
77_D	80_K	0.816	0.91
24_R	28_I	0.814	0.91
53_S	63_A	0.790	0.89
95_F	99_T	0.782	0.89
22_T	39_V	0.765	0.88
86_Q	90_E	0.757	0.87
83_D	87_A	0.750	0.87
86_Q	93_D	0.748	0.86
21_I	69_D	0.738	0.86
75_V	87_A	0.737	0.86
61_N	64_L	0.734	0.85
55_V	59_M	0.728	0.85
50_V	97_K	0.726	0.85
46_V	78_A	0.723	0.85
73_H	77_D	0.716	0.84
76_A	84_G	0.709	0.83
28_I	58_A	0.705	0.83
46_V	87_A	0.705	0.83
62_V	65_H	0.702	0.83
83_D	86_Q	0.698	0.82
71_A	91_L	0.695	0.82
37_N	40_E	0.694	0.82
72_H	89_S	0.694	0.82
60_K	63_A	0.689	0.82
33_R	37_N	0.686	0.81
70_H	75_V	0.652	0.78
33_R	36_Q	0.650	0.78
21_I	62_V	0.649	0.78
31_Q	55_V	0.642	0.77
81_S	86_Q	0.618	0.74
80_K	84_G	0.600	0.72
15_S	19_D	0.597	0.72
20_Q	61_N	0.591	0.71
57_A	100_K	0.586	0.70
13_K	17_E	0.573	0.68
64_L	68_E	0.571	0.68
39_V	62_V	0.562	0.67
46_V	94_V	0.561	0.67
87_A	90_E	0.557	0.66
20_Q	42_D	0.556	0.66
76_A	88_I	0.556	0.66
79_I	87_A	0.554	0.66
43_R	47_D	0.547	0.65
60_K	64_L	0.544	0.64
50_V	98_F	0.541	0.64
60_K	99_T	0.536	0.63
57_A	91_L	0.531	0.63
18_K	100_K	0.531	0.63
61_N	96_K	0.528	0.62
18_K	40_E	0.524	0.62
28_I	33_R	0.522	0.61
88_I	92_L	0.519	0.61
44_Y	73_H	0.518	0.61
21_I	73_H	0.518	0.61
54_A	67_L	0.514	0.60
30_G	51_Q	0.512	0.60
80_K	83_D	0.512	0.60
75_V	78_A	0.511	0.60
15_S	18_K	0.511	0.60
38_M	43_R	0.510	0.60
18_K	39_V	0.506	0.59
27_R	32_V	0.501	0.58
75_V	90_E	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4m1pA	3	0.9505	100	0.156	Contact Map
4adzA	4	0.8713	100	0.168	Contact Map
2hh7A	3	0.8416	100	0.22	Contact Map
3aaiA	3	0.802	100	0.237	Contact Map
2fb5A	3	0.8812	76.6	0.874	Contact Map
4qinA	2	0.8317	27.7	0.908	Contact Map
4r3zB	1	0.8416	13.2	0.921	Contact Map
3n00A	2	0.3564	10.7	0.924	Contact Map
3hglA	1	0.7228	9.5	0.925	Contact Map
4ltoA	3	0.3861	9.5	0.925	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.