YVSG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YVSG - Uncharacterized protein YvsG

UniProt:	O32205	Sequences: MTGKTHIMGGIASCTAAAYYYGFDPVLMAASGAVGALIPDICHTQSKIGRKFPILSKVVSSVFGHRTFTHSLLFMLIMFFITSTYIPDKNISAGLMIGMASHLILDAWTVNGIKLLFPSTIRVRLPLYMKTGSFSEQLVLAGLTLASCYYFYMLFHGRMF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (151)
Sequences:	772 (566)
Seq/√Len:	46.1

ECOLI - YDJM
BACSU - YVSG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_G	105_L	5.101	1.00
103_L	113_I	5.017	1.00
74_F	99_M	3.715	1.00
49_G	64_G	3.629	1.00
38_I	95_L	3.363	1.00
136_E	140_L	3.073	1.00
74_F	78_M	2.864	1.00
107_A	115_L	2.804	1.00
31_S	35_G	2.772	1.00
31_S	91_I	2.626	1.00
3_G	10_G	2.319	1.00
56_S	64_G	2.313	1.00
105_L	109_T	2.289	1.00
28_M	94_G	2.153	1.00
105_L	129_M	2.072	1.00
75_M	100_A	2.070	1.00
71_S	75_M	2.022	0.99
49_G	56_S	2.012	0.99
14_C	28_M	1.923	0.99
101_S	105_L	1.860	0.99
73_L	117_F	1.839	0.99
52_F	56_S	1.827	0.99
9_G	101_S	1.811	0.99
35_G	95_L	1.798	0.99
54_I	58_V	1.790	0.99
10_G	101_S	1.755	0.98
8_M	12_A	1.675	0.98
114_K	123_V	1.578	0.97
109_T	129_M	1.547	0.96
53_P	56_S	1.530	0.96
1_M	6_H	1.528	0.96
10_G	13_S	1.509	0.96
13_S	104_I	1.502	0.96
32_G	36_A	1.469	0.95
7_I	33_A	1.462	0.95
49_G	63_F	1.449	0.95
117_F	136_E	1.413	0.94
133_S	143_L	1.393	0.93
75_M	103_L	1.375	0.93
69_T	72_L	1.375	0.93
3_G	47_K	1.359	0.93
97_I	142_G	1.326	0.92
71_S	115_L	1.315	0.91
82_T	95_L	1.269	0.90
4_K	133_S	1.262	0.90
94_G	98_G	1.262	0.90
51_K	56_S	1.245	0.89
56_S	69_T	1.228	0.88
13_S	101_S	1.211	0.87
76_L	148_C	1.208	0.87
80_F	145_L	1.207	0.87
46_S	49_G	1.204	0.87
67_T	99_M	1.167	0.85
55_L	58_V	1.142	0.84
5_T	15_T	1.119	0.83
109_T	131_T	1.084	0.81
103_L	115_L	1.069	0.80
44_T	67_T	1.060	0.79
10_G	109_T	1.059	0.79
94_G	150_Y	1.056	0.79
25_P	29_A	1.030	0.77
10_G	36_A	1.030	0.77
42_C	99_M	1.013	0.76
5_T	8_M	1.010	0.76
51_K	131_T	1.007	0.76
71_S	125_L	0.990	0.75
71_S	123_V	0.988	0.74
15_T	19_Y	0.981	0.74
10_G	32_G	0.974	0.73
71_S	74_F	0.966	0.73
140_L	144_T	0.961	0.72
77_I	81_I	0.949	0.71
123_V	126_P	0.945	0.71
49_G	60_S	0.930	0.70
43_H	109_T	0.927	0.70
129_M	135_S	0.924	0.69
109_T	117_F	0.924	0.69
29_A	80_F	0.918	0.69
29_A	85_Y	0.918	0.69
2_T	68_F	0.915	0.69
41_I	52_F	0.914	0.68
27_L	91_I	0.914	0.68
33_A	139_V	0.913	0.68
35_G	38_I	0.913	0.68
36_A	47_K	0.900	0.67
131_T	136_E	0.899	0.67
113_I	142_G	0.886	0.66
130_K	133_S	0.876	0.65
53_P	64_G	0.867	0.64
17_A	88_D	0.866	0.64
119_S	122_R	0.862	0.64
5_T	131_T	0.841	0.62
37_L	131_T	0.841	0.62
61_S	131_T	0.840	0.62
3_G	7_I	0.839	0.62
4_K	137_Q	0.838	0.62
7_I	35_G	0.818	0.60
11_I	29_A	0.816	0.60
5_T	140_L	0.816	0.60
9_G	53_P	0.814	0.59
42_C	67_T	0.811	0.59
17_A	97_I	0.807	0.59
51_K	64_G	0.803	0.58
36_A	39_P	0.798	0.58
23_F	38_I	0.797	0.58
87_P	129_M	0.794	0.58
113_I	140_L	0.792	0.57
12_A	98_G	0.792	0.57
34_V	148_C	0.791	0.57
44_T	126_P	0.785	0.57
72_L	113_I	0.783	0.56
71_S	126_P	0.770	0.55
72_L	123_V	0.759	0.54
53_P	71_S	0.730	0.51
16_A	38_I	0.717	0.50
76_L	83_S	0.711	0.49
27_L	55_L	0.710	0.49
79_F	96_M	0.709	0.49
53_P	57_K	0.709	0.49
89_K	148_C	0.708	0.49
10_G	128_Y	0.703	0.49
51_K	67_T	0.701	0.48
133_S	136_E	0.699	0.48
30_A	73_L	0.699	0.48
27_L	30_A	0.697	0.48
141_A	148_C	0.696	0.48
40_D	66_R	0.694	0.48
49_G	61_S	0.694	0.48
139_V	149_Y	0.691	0.47
42_C	66_R	0.681	0.46
46_S	67_T	0.680	0.46
50_R	150_Y	0.678	0.46
73_L	125_L	0.674	0.46
2_T	43_H	0.669	0.45
14_C	33_A	0.667	0.45
3_G	9_G	0.661	0.45
68_F	125_L	0.660	0.44
75_M	96_M	0.658	0.44
105_L	114_K	0.657	0.44
10_G	105_L	0.657	0.44
86_I	101_S	0.657	0.44
42_C	105_L	0.655	0.44
120_T	145_L	0.653	0.44
71_S	117_F	0.652	0.44
3_G	31_S	0.650	0.43
136_E	143_L	0.649	0.43
93_A	141_A	0.649	0.43
72_L	97_I	0.646	0.43
13_S	100_A	0.644	0.43
38_I	91_I	0.641	0.43
79_F	127_L	0.640	0.42
45_Q	104_I	0.629	0.41
7_I	18_A	0.628	0.41
131_T	140_L	0.625	0.41
91_I	142_G	0.624	0.41
30_A	35_G	0.624	0.41
32_G	101_S	0.621	0.41
43_H	67_T	0.621	0.41
5_T	60_S	0.620	0.41
130_K	143_L	0.619	0.40
66_R	70_H	0.616	0.40
40_D	70_H	0.616	0.40
111_N	114_K	0.612	0.40
4_K	61_S	0.612	0.40
28_M	51_K	0.612	0.40
147_S	150_Y	0.610	0.40
107_A	128_Y	0.609	0.40
117_F	120_T	0.609	0.40
60_S	114_K	0.603	0.39
96_M	101_S	0.598	0.38
66_R	106_D	0.593	0.38
40_D	106_D	0.593	0.38
112_G	131_T	0.591	0.38
2_T	131_T	0.586	0.37
71_S	107_A	0.584	0.37
44_T	110_V	0.579	0.37
31_S	109_T	0.577	0.37
54_I	140_L	0.577	0.37
8_M	73_L	0.576	0.36
15_T	147_S	0.575	0.36
43_H	136_E	0.571	0.36
15_T	148_C	0.565	0.35
73_L	115_L	0.564	0.35
48_I	131_T	0.564	0.35
75_M	113_I	0.563	0.35
9_G	64_G	0.556	0.35
37_L	103_L	0.556	0.35
119_S	127_L	0.555	0.35
71_S	118_P	0.555	0.35
18_A	21_Y	0.555	0.35
80_F	96_M	0.551	0.34
68_F	73_L	0.551	0.34
8_M	139_V	0.551	0.34
42_C	106_D	0.544	0.34
42_C	70_H	0.543	0.34
124_R	127_L	0.541	0.33
78_M	109_T	0.538	0.33
60_S	64_G	0.535	0.33
48_I	109_T	0.534	0.33
34_V	82_T	0.532	0.33
44_T	48_I	0.530	0.32
78_M	143_L	0.530	0.32
133_S	145_L	0.528	0.32
39_P	113_I	0.528	0.32
12_A	21_Y	0.528	0.32
10_G	129_M	0.528	0.32
135_S	146_A	0.525	0.32
27_L	133_S	0.520	0.32
42_C	114_K	0.519	0.31
73_L	132_G	0.515	0.31
33_A	113_I	0.514	0.31
48_I	112_G	0.513	0.31
70_H	106_D	0.513	0.31
26_V	98_G	0.512	0.31
38_I	45_Q	0.512	0.31
110_V	130_K	0.510	0.31
69_T	79_F	0.510	0.31
41_I	82_T	0.508	0.31
108_W	150_Y	0.505	0.30
17_A	80_F	0.504	0.30
64_G	76_L	0.503	0.30
107_A	136_E	0.503	0.30
34_V	47_K	0.502	0.30
99_M	103_L	0.502	0.30
31_S	94_G	0.501	0.30
15_T	29_A	0.500	0.30

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4p6vB	1	0.325	4	0.953	Contact Map
4ednK	1	0.1187	3.8	0.953	Contact Map
2mm4A	1	0.1938	2.1	0.959	Contact Map
2mc7A	1	0.1875	1.5	0.963	Contact Map
3tl8B	1	0.3688	1.3	0.964	Contact Map
2wtgA	2	0.3937	1.3	0.964	Contact Map
2nw8A	4	0.2625	1.2	0.964	Contact Map
3am6A	3	0.3375	1.1	0.965	Contact Map
2b9iC	1	0.0875	1.1	0.966	Contact Map
2lf6A	1	0.4062	0.8	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.