LIAH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

LIAH - Protein LiaH

UniProt:	O32201	Sequences: MVLKRIRDMFVASVHEGLDKMENPKVMLNQYVRDMESDIAKAKQTIVKQHTIAYQFKKKYEEAAEVAGKRKNQAQLAFDAGEEELAKKALTEMKYLEGKAAEHKASYEQANSQLADLKEQLAALETKLQDVKDKKQALIARANAAKAKEHMNTTFDKIDSESAYREFLRIENRIEEMEIRANYSKSAEAGTELTRKEFADDVEAEIEKMRTLSLQKSDQTKAANE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	225 (212)
Sequences:	1627 (1060)
Seq/√Len:	72.8

ECOLI - PSPA YJFJ
BACSU - LIAH PSPA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
78_F	83_E	5.605	1.00
75_Q	212_L	4.447	1.00
67_A	100_A	3.182	1.00
60_Y	104_K	2.899	1.00
71_K	75_Q	2.807	1.00
57_K	61_E	2.806	1.00
104_K	108_E	2.759	1.00
30_Q	34_D	2.692	1.00
87_K	203_E	2.664	1.00
64_A	104_K	2.628	1.00
141_R	178_E	2.614	1.00
149_E	180_R	2.484	1.00
93_M	205_E	2.475	1.00
204_A	207_E	2.406	1.00
146_K	150_H	2.334	1.00
134_K	171_E	2.239	1.00
83_E	210_R	2.183	1.00
70_R	73_Q	2.143	1.00
60_Y	100_A	2.130	1.00
75_Q	79_D	2.128	1.00
53_A	111_N	2.108	1.00
193_L	197_E	2.022	1.00
69_K	73_Q	2.017	1.00
189_A	192_E	2.014	1.00
207_E	211_T	2.011	1.00
29_N	135_K	1.999	1.00
108_E	112_S	1.991	1.00
75_Q	209_M	1.958	1.00
43_K	125_E	1.945	1.00
203_E	207_E	1.940	1.00
130_D	134_K	1.921	1.00
60_Y	64_A	1.819	1.00
189_A	193_L	1.818	1.00
64_A	100_A	1.808	1.00
97_E	101_A	1.803	1.00
208_K	212_L	1.797	1.00
5_R	22_E	1.785	1.00
7_R	11_V	1.766	1.00
67_A	97_E	1.729	1.00
101_A	104_K	1.713	1.00
36_E	132_K	1.671	1.00
190_G	193_L	1.668	1.00
71_K	212_L	1.662	1.00
30_Q	33_R	1.649	1.00
208_K	211_T	1.648	1.00
203_E	213_S	1.639	1.00
193_L	196_K	1.603	0.99
13_S	26_V	1.601	0.99
68_G	72_N	1.598	0.99
145_A	181_A	1.588	0.99
71_K	208_K	1.581	0.99
78_F	213_S	1.560	0.99
69_K	72_N	1.525	0.99
46_I	117_L	1.515	0.99
176_E	180_R	1.506	0.99
205_E	208_K	1.496	0.99
64_A	68_G	1.480	0.99
112_S	116_D	1.479	0.99
29_N	139_I	1.434	0.99
74_A	209_M	1.430	0.99
19_D	22_E	1.429	0.99
53_A	114_L	1.403	0.98
194_T	197_E	1.399	0.98
82_E	192_E	1.394	0.98
94_K	201_D	1.351	0.98
60_Y	107_Y	1.349	0.98
19_D	33_R	1.323	0.98
188_E	191_T	1.320	0.98
53_A	57_K	1.294	0.97
189_A	195_R	1.288	0.97
46_I	121_L	1.280	0.97
21_M	26_V	1.273	0.97
32_V	128_L	1.266	0.97
55_Q	59_K	1.244	0.97
78_F	209_M	1.227	0.96
12_A	16_E	1.220	0.96
101_A	105_A	1.217	0.96
111_N	115_A	1.186	0.96
65_E	69_K	1.184	0.96
120_Q	123_A	1.180	0.95
93_M	97_E	1.179	0.95
61_E	64_A	1.176	0.95
98_G	101_A	1.169	0.95
79_D	213_S	1.167	0.95
75_Q	213_S	1.155	0.95
11_V	34_D	1.130	0.94
87_K	202_V	1.125	0.94
138_L	174_I	1.100	0.93
14_V	17_G	1.100	0.93
183_Y	187_A	1.081	0.93
67_A	93_M	1.055	0.92
76_L	80_A	1.046	0.92
127_K	130_D	1.027	0.91
142_A	146_K	1.024	0.91
34_D	37_S	1.001	0.90
39_I	128_L	0.996	0.90
78_F	210_R	0.994	0.89
72_N	75_Q	0.989	0.89
57_K	107_Y	0.984	0.89
27_M	30_Q	0.979	0.89
16_E	26_V	0.975	0.88
98_G	201_D	0.955	0.87
126_T	130_D	0.955	0.87
85_L	196_K	0.952	0.87
60_Y	108_E	0.942	0.87
115_A	119_E	0.934	0.86
28_L	167_F	0.920	0.85
84_E	192_E	0.920	0.85
23_N	26_V	0.919	0.85
110_A	114_L	0.916	0.85
9_M	28_L	0.915	0.85
16_E	20_K	0.907	0.85
124_L	131_V	0.903	0.84
211_T	214_L	0.894	0.84
61_E	65_E	0.893	0.84
192_E	196_K	0.891	0.84
139_I	143_N	0.888	0.83
122_A	126_T	0.885	0.83
74_A	183_Y	0.878	0.83
53_A	107_Y	0.875	0.82
63_A	96_L	0.874	0.82
128_L	166_E	0.859	0.81
204_A	208_K	0.852	0.81
25_K	29_N	0.844	0.80
73_Q	76_L	0.842	0.80
74_A	90_L	0.841	0.80
70_R	92_E	0.840	0.80
15_H	33_R	0.839	0.80
149_E	153_T	0.833	0.79
8_D	11_V	0.832	0.79
88_K	91_T	0.828	0.79
8_D	13_S	0.824	0.78
167_F	177_M	0.820	0.78
191_T	194_T	0.818	0.78
34_D	38_D	0.815	0.78
152_N	155_F	0.812	0.77
163_A	167_F	0.812	0.77
71_K	93_M	0.811	0.77
91_T	95_Y	0.809	0.77
8_D	166_E	0.809	0.77
83_E	176_E	0.806	0.77
92_E	95_Y	0.805	0.77
169_R	172_N	0.801	0.76
14_V	21_M	0.798	0.76
63_A	99_K	0.793	0.76
38_D	42_A	0.793	0.76
117_L	147_A	0.779	0.74
78_F	203_E	0.778	0.74
37_S	41_K	0.775	0.74
149_E	181_A	0.774	0.74
28_L	135_K	0.772	0.74
62_E	115_A	0.770	0.74
195_R	199_A	0.760	0.73
153_T	184_S	0.760	0.73
106_S	110_A	0.758	0.72
109_Q	113_Q	0.753	0.72
5_R	24_P	0.752	0.72
90_L	93_M	0.750	0.72
71_K	78_F	0.748	0.71
25_K	143_N	0.742	0.71
62_E	68_G	0.739	0.71
123_A	126_T	0.739	0.71
105_A	207_E	0.738	0.70
28_L	35_M	0.734	0.70
46_I	49_Q	0.733	0.70
25_K	127_K	0.728	0.69
153_T	172_N	0.725	0.69
209_M	213_S	0.723	0.69
12_A	27_M	0.719	0.68
59_K	62_E	0.719	0.68
17_G	21_M	0.717	0.68
12_A	20_K	0.713	0.68
31_Y	70_R	0.713	0.68
209_M	212_L	0.710	0.67
76_L	79_D	0.710	0.67
188_E	192_E	0.707	0.67
47_V	55_Q	0.707	0.67
5_R	12_A	0.707	0.67
77_A	196_K	0.705	0.67
8_D	135_K	0.703	0.67
10_F	17_G	0.700	0.66
108_E	111_N	0.700	0.66
172_N	176_E	0.698	0.66
28_L	170_I	0.698	0.66
66_V	96_L	0.698	0.66
15_H	148_K	0.695	0.66
64_A	108_E	0.693	0.66
167_F	171_E	0.693	0.66
107_Y	111_N	0.691	0.65
25_K	131_V	0.689	0.65
70_R	89_A	0.686	0.65
100_A	199_A	0.685	0.65
18_L	22_E	0.685	0.65
8_D	18_L	0.682	0.64
190_G	194_T	0.678	0.64
83_E	87_K	0.677	0.64
62_E	65_E	0.670	0.63
71_K	97_E	0.668	0.63
189_A	194_T	0.664	0.62
54_Y	182_N	0.664	0.62
76_L	185_K	0.661	0.62
4_K	195_R	0.657	0.61
73_Q	143_N	0.653	0.61
110_A	113_Q	0.651	0.61
39_I	47_V	0.645	0.60
89_A	193_L	0.643	0.60
82_E	85_L	0.642	0.60
191_T	195_R	0.642	0.60
83_E	90_L	0.641	0.60
195_R	198_F	0.640	0.59
129_Q	133_D	0.639	0.59
103_H	106_S	0.637	0.59
11_V	30_Q	0.635	0.59
105_A	108_E	0.635	0.59
89_A	127_K	0.634	0.59
39_I	55_Q	0.634	0.59
113_Q	116_D	0.633	0.59
45_T	143_N	0.629	0.58
32_V	36_E	0.627	0.58
10_F	14_V	0.624	0.58
83_E	86_A	0.624	0.58
50_H	118_K	0.622	0.57
194_T	198_F	0.622	0.57
71_K	91_T	0.620	0.57
29_N	137_A	0.619	0.57
36_E	128_L	0.617	0.57
156_D	159_D	0.615	0.56
73_Q	89_A	0.614	0.56
90_L	94_K	0.614	0.56
98_G	102_E	0.608	0.56
49_Q	144_A	0.606	0.55
8_D	27_M	0.605	0.55
86_A	90_L	0.604	0.55
39_I	43_K	0.602	0.55
67_A	102_E	0.601	0.55
39_I	125_E	0.597	0.54
31_Y	170_I	0.596	0.54
32_V	132_K	0.596	0.54
19_D	27_M	0.596	0.54
104_K	107_Y	0.596	0.54
62_E	138_L	0.596	0.54
35_M	131_V	0.590	0.53
56_F	60_Y	0.589	0.53
63_A	103_H	0.588	0.53
25_K	35_M	0.586	0.53
61_E	214_L	0.584	0.53
192_E	197_E	0.583	0.53
177_M	180_R	0.581	0.52
48_K	66_V	0.580	0.52
22_E	27_M	0.574	0.51
8_D	167_F	0.573	0.51
94_K	205_E	0.572	0.51
147_A	150_H	0.567	0.51
113_Q	120_Q	0.565	0.50
57_K	111_N	0.565	0.50
15_H	30_Q	0.564	0.50
70_R	193_L	0.563	0.50
88_K	149_E	0.563	0.50
190_G	195_R	0.559	0.50
24_P	89_A	0.559	0.50
140_A	147_A	0.556	0.49
75_Q	208_K	0.556	0.49
150_H	153_T	0.556	0.49
160_S	181_A	0.555	0.49
168_L	172_N	0.554	0.49
192_E	195_R	0.553	0.49
91_T	202_V	0.553	0.49
46_I	147_A	0.553	0.49
134_K	138_L	0.552	0.49
174_I	179_I	0.551	0.49
136_Q	145_A	0.551	0.49
32_V	135_K	0.551	0.49
90_L	181_A	0.550	0.48
190_G	196_K	0.550	0.48
59_K	169_R	0.548	0.48
63_A	100_A	0.548	0.48
87_K	90_L	0.547	0.48
18_L	21_M	0.547	0.48
31_Y	73_Q	0.546	0.48
21_M	196_K	0.544	0.48
50_H	114_L	0.542	0.47
119_E	161_E	0.539	0.47
8_D	128_L	0.538	0.47
105_A	109_Q	0.537	0.47
58_K	150_H	0.536	0.47
38_D	185_K	0.535	0.47
204_A	213_S	0.535	0.47
50_H	181_A	0.534	0.46
27_M	174_I	0.532	0.46
13_S	21_M	0.529	0.46
31_Y	166_E	0.528	0.46
87_K	94_K	0.526	0.45
68_G	105_A	0.526	0.45
55_Q	62_E	0.523	0.45
49_Q	166_E	0.522	0.45
38_D	152_N	0.521	0.45
12_A	24_P	0.521	0.45
79_D	214_L	0.520	0.45
45_T	52_I	0.520	0.45
90_L	124_L	0.520	0.45
13_S	25_K	0.517	0.44
8_D	34_D	0.517	0.44
35_M	128_L	0.516	0.44
76_L	197_E	0.516	0.44
70_R	127_K	0.516	0.44
77_A	127_K	0.514	0.44
60_Y	96_L	0.514	0.44
78_F	86_A	0.513	0.44
25_K	70_R	0.510	0.44
78_F	93_M	0.509	0.43
149_E	185_K	0.509	0.43
38_D	41_K	0.508	0.43
116_D	120_Q	0.508	0.43
151_M	170_I	0.508	0.43
80_A	200_D	0.506	0.43
63_A	82_E	0.505	0.43
43_K	177_M	0.503	0.43
21_M	37_S	0.500	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1i84S	2	0.0089	89.4	0.899	Contact Map
2gd5A	2	0.6844	87.2	0.902	Contact Map
4abmA	2	0.3511	82.5	0.908	Contact Map
3frtA	1	0.6178	80.8	0.91	Contact Map
3ojaB	1	0.5111	74.1	0.915	Contact Map
2dfsA	2	0.5556	63.6	0.921	Contact Map
1c1gA	2	0.9467	63.1	0.921	Contact Map
3mq9A	4	0.5467	62.3	0.922	Contact Map
4iloA	3	0.7333	52.2	0.926	Contact Map
4cgkA	3	0.6667	51.5	0.927	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.